DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and UGT76C2

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_196205.1 Gene:UGT76C2 / 830471 AraportID:AT5G05860 Length:450 Species:Arabidopsis thaliana


Alignment Length:505 Identity:114/505 - (22%)
Similarity:177/505 - (35%) Gaps:159/505 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GARILALFPVPSHSHYYHALPYLKNLASLGHEITSV-----SPFPSEEPVKNIYDIYVPEVLNSF 79
            |.|:: |||:|........|.....|...|..||.:     :|..|..|:...  :.:|:.|:..
plant     7 GLRVI-LFPLPLQGCINPMLQLANILHVRGFSITVIHTRFNAPKASSHPLFTF--LQIPDGLSET 68

  Fly    80 D------ELLKQMTTPKNTWEFFDATNEFVYNITKDVFNNDGVRREILRPGKAQFDLIIVDI--W 136
            :      .||.|:.        .:|.:.|          .|.:|:.:|...:::....::|.  |
plant    69 EIQDGVMSLLAQIN--------LNAESPF----------RDCLRKVLLESKESERVTCLIDDCGW 115

  Fly   137 KYDAFYS-------------LAAYFEA----PII---GLAPCGIDWKIDEMVGNPSPMSYLQSPS 181
            .:....|             .|.:|.|    |:|   |..|.. :.:.::.|....|:.  :...
plant   116 LFTQSVSESLKLPRLVLCTFKATFFNAYPSLPLIRTKGYLPVS-ESEAEDSVPEFPPLQ--KRDL 177

  Fly   182 SYLY-----NLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKIAETKPLSEISQDIAL 241
            |.::     .||.|   :..|||..|          :....:|..          ..|:.:| :|
plant   178 SKVFGEFGEKLDPF---LHAVVETTI----------RSSGLIYMS----------CEELEKD-SL 218

  Fly   242 VLVNQHFTLGPPRPYVPNVIEVGGMHI------------DEQPKALAQDLEDFIQGSGEHGVIYF 294
            .|.|:.|.       || |..:|..|.            ||.......|.||       ..|||.
plant   219 TLSNEIFK-------VP-VFAIGPFHSYFSASSSSLFTQDETCILWLDDQED-------KSVIYV 268

  Fly   295 SLGTNVRTKNMVDDRKRILIEAFGSLPQRVLWKFEDEELQDIPSNVL------------------ 341
            |||:.|   |:.:.....:.....:..|..||...       |.:||                  
plant   269 SLGSVV---NITETEFLEIACGLSNSKQPFLWVVR-------PGSVLGAKWIEPLSEGLVSSLEE 323

  Fly   342 ---VRKWLPQQDLLAHPKVKLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTN---VDHIKKHGF 400
               :.||.|||::|||.....|:||.|..||:|||..|.||:.||..:||..|   |..|.|.|.
plant   324 KGKIVKWAPQQEVLAHRATGGFLTHNGWNSTLESICEGVPMICLPGGWDQMLNSRFVSDIWKIGI 388

  Fly   401 CLSLNYHDMTSDELKATILQLLTEKRFEVTARIAGARYRDQPMKPLETAV 450
            .|.   ..:...|::..:..|:.|..        |.:.|:: ||.|:..|
plant   389 HLE---GRIEKKEIEKAVRVLMEESE--------GNKIRER-MKVLKDEV 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 114/505 (23%)
UDPGT 33..484 CDD:278624 108/492 (22%)
UGT76C2NP_196205.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 114/505 (23%)
YjiC 9..429 CDD:224732 113/503 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.