DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and AT4G14090

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_193146.1 Gene:AT4G14090 / 827046 AraportID:AT4G14090 Length:456 Species:Arabidopsis thaliana


Alignment Length:423 Identity:102/423 - (24%)
Similarity:152/423 - (35%) Gaps:118/423 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFPVPSHSHYYHALPYLKNLASLGHEI---TSVSPF------PS-------------EEPVKNIY 68
            |...|:..|...||.....|...|..:   |:||..      ||             ::.:|:..
plant    16 LVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPSTKGLSFAWFTDGFDDGLKSFE 80

  Fly    69 D--IYVPEV----LNSFDELLKQMTTPKNTWEFFDATNEFVYNITKDVFNNDGVRREILRPGKA- 126
            |  ||:.|:    .|:..:::|..         .|||.|     |:.:   .||...:|.|..: 
plant    81 DQKIYMSELKRCGSNALRDIIKAN---------LDATTE-----TEPI---TGVIYSVLVPWVST 128

  Fly   127 ---QFDL----------IIVDIWKYDAFYSLAAYFEAPIIGLAPCGIDWKIDEMVGNPSPMSYLQ 178
               :|.|          .::||:.|....|....|:...|.|.      |:..:.....| |:||
plant   129 VAREFHLPTTLLWIEPATVLDIYYYYFNTSYKHLFDVEPIKLP------KLPLITTGDLP-SFLQ 186

  Fly   179 SPSSYLYNLDTFGGRVAHVVEVAISWFNWHWRYEQKH-EALYKKYFPKIAETKPLSEISQDIALV 242
            ...:....|.|.                      ::| |||..:..|||. ....|.:..| ||.
plant   187 PSKALPSALVTL----------------------REHIEALETESNPKIL-VNTFSALEHD-ALT 227

  Fly   243 LVNQHFTLGPPRPYVPNVIEVGGMHIDEQPKALAQDLEDFIQGSGEHGVIYFSLGTNVRTKNMVD 307
            .|.:...:    |..|.|....|.  .:..|:..:|...::....|..|||.||||:      .|
plant   228 SVEKLKMI----PIGPLVSSSEGK--TDLFKSSDEDYTKWLDSKLERSVIYISLGTH------AD 280

  Fly   308 DRKRILIEAF--GSLP--QRVLWKFEDEELQDIPSN-----------VLVRKWLPQQDLLAHPKV 357
            |.....:||.  |.|.  :..||...::..::...|           .||..|..|..:|||..|
plant   281 DLPEKHMEALTHGVLATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHCAV 345

  Fly   358 KLFITHGGMQSTIESIHYGKPMLGLPFFYDQFT 390
            ..|:||.|..||:||:..|.|::..|.|.||.|
plant   346 GCFVTHCGWNSTLESLESGVPVVAFPQFADQCT 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 102/423 (24%)
UDPGT 33..484 CDD:278624 100/416 (24%)
AT4G14090NP_193146.1 YjiC 11..445 CDD:224732 102/423 (24%)
Glycosyltransferase_GTB_type 12..454 CDD:299143 102/423 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.