DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and AT3G46700

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_190254.2 Gene:AT3G46700 / 823823 AraportID:AT3G46700 Length:447 Species:Arabidopsis thaliana


Alignment Length:268 Identity:63/268 - (23%)
Similarity:100/268 - (37%) Gaps:86/268 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DEMVGNPSPMSYLQSPSSYLYNLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKIAET 229
            :::|.|..|:.|...|::      |||                                    |.
plant   161 NKVVENMHPLRYKDLPTA------TFG------------------------------------EL 183

  Fly   230 KPLSEISQDI------ALVLVN-------QHFTLGPPRPYVPNVIEVGGMHIDEQPKALAQDLED 281
            :|..|:.:|:      :.|::|       ...|.......:| |..:|.:||.:.........||
plant   184 EPFLELCRDVVNKRTASAVIINTVTCLESSSLTRLQQELQIP-VYPLGPLHITDSSTGFTVLQED 247

  Fly   282 -----FIQGSGEHGVIYFSLGTNV--RTKNMVDDRKRILIEAFGSL--PQRVLWKFE------DE 331
                 ::.......|||.|||:.|  .||.|::       .|:|.|  .|..||...      .|
plant   248 RSCVEWLNKQKPRSVIYISLGSMVLMETKEMLE-------MAWGMLNSNQPFLWVIRPGSVSGSE 305

  Fly   332 ELQDIPSNV--------LVRKWLPQQDLLAHPKVKLFITHGGMQSTIESIHYGKPMLGLPFFYDQ 388
            .::.:|..|        .:.||.||.::|.||.|..|.:|.|..||:|||..|.||:..|:..:|
plant   306 GIESLPEEVSKMVLEKGYIVKWAPQIEVLGHPSVGGFWSHCGWNSTLESIVEGVPMICRPYQGEQ 370

  Fly   389 FTNVDHIK 396
            ..|..:::
plant   371 MLNAIYLE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 63/268 (24%)
UDPGT 33..484 CDD:278624 63/268 (24%)
AT3G46700NP_190254.2 Glycosyltransferase_GTB_type 1..446 CDD:299143 63/268 (24%)
YjiC 7..426 CDD:224732 63/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.