DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and UGT76E12

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_566885.1 Gene:UGT76E12 / 823819 AraportID:AT3G46660 Length:458 Species:Arabidopsis thaliana


Alignment Length:433 Identity:92/433 - (21%)
Similarity:161/433 - (37%) Gaps:114/433 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RILALFPVPSHSHYYHALPYLKNLASLGHEITSVSP-----FPSEEPVKNIYDIYVPEVLNSFDE 81
            |.:.|.|.|:..|....:...|.|...|..||.|..     .||::...:...:.:||.|...|.
plant    13 RSVVLVPFPAQGHISPMMQLAKTLHLKGFSITVVQTKFNYFSPSDDFTHDFQFVTIPESLPESDF 77

  Fly    82 LLKQMTTPKNTWEFFDATNEFVYNITKD--VFNNDGVRREILRPGKAQFDLIIVDIWKY------ 138
                    ||....     :|::.:.|:  |...|.:.:.:|:... :...:|.|.:.|      
plant    78 --------KNLGPI-----QFLFKLNKECKVSFKDCLGQLVLQQSN-EISCVIYDEFMYFAEAAA 128

  Fly   139 ------------------------DAFYSLAAYFEAPIIGLAPCGIDWKIDEMVGNPSPMSYLQS 179
                                    |..|  |...:||:     .....:.:|:|....|:.|...
plant   129 KECKLPNIIFSTTSATAFACRSVFDKLY--ANNVQAPL-----KETKGQQEELVPEFYPLRYKDF 186

  Fly   180 PSSYLYNLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKIAETKPLSEISQDIALVLV 244
            |.|...:|::       ::||                      :....:.:..|.:..:.|..|.
plant   187 PVSRFASLES-------IMEV----------------------YRNTVDKRTASSVIINTASCLE 222

  Fly   245 NQHFT-LGPPRPYVPNVIEVGGMH-IDEQPKALAQDLEDFIQGSGE---HGVIYFSLGTNVRTKN 304
            :...: |...:..:| |..:|.:| :...|.:|.::.:..|:...:   :.|||.|:|:..    
plant   223 SSSLSFLQQQQLQIP-VYPIGPLHMVASAPTSLLEENKSCIEWLNKQKVNSVIYISMGSIA---- 282

  Fly   305 MVDDRKRILIEAFG--SLPQRVLWKFE------DEELQDIPSN----VLVR----KWLPQQDLLA 353
             :.:...|:..|.|  :..|..||...      .|.::.:|..    ||.|    ||.||:::|:
plant   283 -LMEINEIMEVASGLAASNQHFLWVIRPGSIPGSEWIESMPEEFSKMVLDRGYIVKWAPQKEVLS 346

  Fly   354 HPKVKLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTNVDHIK 396
            ||.|..|.:|.|..||:|||..|.||:..||..||..|..:::
plant   347 HPAVGGFWSHCGWNSTLESIGQGVPMICRPFSGDQKVNARYLE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 92/433 (21%)
UDPGT 33..484 CDD:278624 88/422 (21%)
UGT76E12NP_566885.1 PLN02410 6..458 CDD:178032 92/433 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.