DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and AT3G46650

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_190249.4 Gene:AT3G46650 / 823818 AraportID:AT3G46650 Length:435 Species:Arabidopsis thaliana


Alignment Length:418 Identity:94/418 - (22%)
Similarity:157/418 - (37%) Gaps:103/418 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RILALFPVPSHSHYYHALPYLKNLASLGHEITSVSPF-----PSEEPVKNIYDIYVPEVL--NSF 79
            |.:.|.|:|:..|....:...|.|.|.|..||.|...     .|.:.......:.:.|.|  :.|
plant     9 RRIVLVPIPAQGHVTPLMQLGKVLNSKGFSITVVEGHFNQVSSSSQHFPGFQFVTIKESLPESEF 73

  Fly    80 DEL--LKQMTTPKNTWEFFDATNEFVYNITKDVFNNDGVRREILRPGKAQFDLIIVDIWKYDAFY 142
            ::|  ::.|.|               .|.|.:....|.:.:.:|:.|. ....||.|.:.|  |.
plant    74 EKLGGIESMIT---------------LNKTSEASFKDCISQLLLQQGN-DIACIIYDEYMY--FC 120

  Fly   143 SLAA-YFEAP-IIGLAPCGIDW-----KIDEMVGNPSPMSYLQSPSSYLYNLDTFGGRVAHVVEV 200
            ..|| .|..| :|.......::     ..|::|.|..|:.|...|:|.:..||.|          
plant   121 GAAAKEFSIPSVIFSTQSAANYVSHPDMQDKVVENLYPLRYKDLPTSGMGPLDRF---------- 175

  Fly   201 AISWFNWHWRYEQKHEALYKKYFPKI-------AETKPLSEISQDIALVLVNQHFTLGPPRPYVP 258
                      :|...|...|:....:       .|:..||.:.|.:.:.:    :.|||      
plant   176 ----------FELCREVANKRTASAVIINTVSCLESSSLSWLEQKVGISV----YPLGP------ 220

  Fly   259 NVIEVGGMHI-DEQPKALAQDLEDFIQGSGEH---GVIYFSLGTNVRTKNMVDDRKRILIEAFG- 318
                   :|: |..|.:|.::....|:...:.   .|||.|:||..:.     :.|.:|..::| 
plant   221 -------LHMTDSSPSSLLEEDRSCIEWLNKQKPKSVIYISIGTLGQM-----ETKEVLEMSWGL 273

  Fly   319 -SLPQRVLWKFE------DEELQDIPSNV--------LVRKWLPQQDLLAHPKVKLFITHGGMQS 368
             :..|..||...      ...::.:|.:|        .:.|..||.::|.||.|..|.:|.|..|
plant   274 CNSNQPFLWVIRAGSILGTNGIESLPEDVNKMVSERGYIVKRAPQIEVLGHPAVGGFWSHCGWNS 338

  Fly   369 TIESIHYGKPMLGLPFFYDQFTNVDHIK 396
            .:|||..|.||:..||..:|..|..:::
plant   339 ILESIGEGVPMICKPFHGEQKLNAMYLE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 94/418 (22%)
UDPGT 33..484 CDD:278624 90/407 (22%)
AT3G46650NP_190249.4 Glycosyltransferase_GTB-type 1..435 CDD:385653 94/418 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.