DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and UGT2B10

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001066.1 Gene:UGT2B10 / 7365 HGNCID:12544 Length:528 Species:Homo sapiens


Alignment Length:520 Identity:156/520 - (30%)
Similarity:266/520 - (51%) Gaps:39/520 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIILLFPGFLYGARILALFPVPSHSHYYHALPYLKNLASLGHEIT------SVSPFPSEEPVKNI 67
            |:|.|...|..|:....|.....:|.:.:....||.|...|||:|      |:...|::.....:
Human     9 LLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSSTLKL 73

  Fly    68 YDIYVPEVLNS-FDELLKQMT-----TPKNT-W-------EFFDATNEFVYNITKDVFNNDGVRR 118
             ::|...:..: |:.::.|:.     ..|:| |       |...|.|:.:.|..|||.:|..:.:
Human    74 -EVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMK 137

  Fly   119 EILRPGKAQFDLIIVDIWKYDAFYSLAAYFEAPIIGLAPCGIDWKIDEMVGN-PSPMSYLQSPSS 182
            ::   .:::||::..|.: ......||..|..|.:........:..:...|. ..|.||:....|
Human   138 KL---QESRFDIVFADAY-LPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMS 198

  Fly   183 YLYNLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKI-AETKPLSEISQDIALVLVNQ 246
            .|.:..||..||.:::.|....| |...:..|.   :.:::.:: .....|||..:...:.|:..
Human   199 KLSDQMTFMERVKNMLYVLYFDF-WFQIFNMKK---WDQFYSEVLGRPTTLSETMRKADIWLMRN 259

  Fly   247 HFTLGPPRPYVPNVIEVGGMHIDEQPKALAQDLEDFIQGSGEHGVIYFSLGTNVRTKNMVDDRKR 311
            .:....|.|::|||..|||:|. :..|.|.:::|:|:|.|||:||:.||||:.|  .||.::|..
Human   260 SWNFKFPHPFLPNVDFVGGLHC-KPAKPLPKEMEEFVQSSGENGVVVFSLGSMV--SNMTEERAN 321

  Fly   312 ILIEAFGSLPQRVLWKFEDEELQDIPSNVLVRKWLPQQDLLAHPKVKLFITHGGMQSTIESIHYG 376
            ::..|...:||:|||:|:..:...:..|..:.||:||.|||.|||.:.||||||.....|:|::|
Human   322 VIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHG 386

  Fly   377 KPMLGLPFFYDQFTNVDHIKKHGFCLSLNYHDMTSDELKATILQLLTEKRFEVTARIAGARYRDQ 441
            .||:|:|.|:||..|:.|:|..|..:.::::.|:|.:|...:..::.:..::...........||
Human   387 IPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQ 451

  Fly   442 PMKPLETAVWWTHYVLRHKGAPHMRVAGRKLSFFTHHSLDVLGTVLLVILLVIIAILLIIVFSVC 506
            |:|||:.||:|..:|:|||||.|:|||...|::|.:|||||:|     .||..:|.:|.|:...|
Human   452 PVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIG-----FLLACVATVLFIITKCC 511

  Fly   507  506
            Human   512  511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 135/473 (29%)
UDPGT 33..484 CDD:278624 143/472 (30%)
UGT2B10NP_001066.1 UDPGT 23..524 CDD:278624 151/506 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150478
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - mtm8543
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.690

Return to query results.
Submit another query.