DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and UGT2A2

DIOPT Version :10

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001099147.2 Gene:UGT2A2 / 574537 HGNCID:28183 Length:536 Species:Homo sapiens


Alignment Length:85 Identity:18/85 - (21%)
Similarity:36/85 - (42%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQSLQLLTFV---LIALMVSVTFAEIIQKGKLAKHGMLKENKPNCLLTRSRLGCTCTTCKEIVNF 62
            |:|..||...   .:|:...:.::.|:...::||.|::...|...|:.....     |.|.:...
Human   119 MESSVLLIMSFDRFLAIRNPLRYSSILTSARVAKMGLVFLIKSMLLVLPFPF-----TLKRLAYC 178

  Fly    63 TRMLILNHVPEEQEVMEKVC 82
            .:.|:.:.....|:||:..|
Human   179 QKSLLSHSYCLHQDVMKLAC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 Glycosyltransferase_GTB-type 33..484 CDD:471961 10/50 (20%)
UGT2A2NP_001099147.2 UDPGT 30..524 CDD:278624 18/85 (21%)

Return to query results.
Submit another query.