DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and Ugt37A2

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster


Alignment Length:560 Identity:166/560 - (29%)
Similarity:267/560 - (47%) Gaps:74/560 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGLFYLI--ILLFPGFLYGARILALFPVPSHSHYYHALPYLKNLASLGHEITSVSPFPSEEPV-- 64
            ||::.|:  .:...|..:||.||.:|...|.||....:...|.||..||.:|.::..   :||  
  Fly     5 SGIYLLLATAICVLGGCHGANILGVFTSLSPSHLIIQMSTAKVLAERGHNVTVITVL---KPVVN 66

  Fly    65 -KNIYDIYVPEVLNSFDELLKQMTTPKNTWEFFDATN------------EFVYNITKDVFNNDGV 116
             |||..|.||..    .|..:||:.........|.:|            ||:::.......:|.|
  Fly    67 HKNITVIMVPLT----KEESQQMSDTIGAMSKTDNSNMILSMLRMMGQMEFMFDKMAGALKDDRV 127

  Fly   117 RREIL-RPGKAQFDLIIVDIWKYDAFYSLAAYFEAPIIGLAPCGIDWKIDEMVGNPSPMSYLQSP 180
            |...| |..|  |||::...:........|...:||:|.:|....:..::.::|||..::|:.|.
  Fly   128 RDLYLNRDNK--FDLVLSGYFMNVYQLGFAKKVKAPVIVVATMPPNQLLNPLIGNPLEIAYVPSI 190

  Fly   181 SSYL--------------YNLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKIAETKP 231
            |..:              |:...|.|....|.             :::.:.|||:.|........
  Fly   191 SDSVEKGKGMSFRQRLAGYSSSFFFGIFDFVT-------------QRRSKRLYKELFGDDPNMPE 242

  Fly   232 LSEISQDIALVLVNQHF-TLGPPRPYVPNVIEVGGMHIDEQPKALAQDLEDFIQGSGEHGVIYFS 295
            .||:.::.:|:....|. :.||.||.||..||:||:.:.:.|..|.|::.:|: |:...|.|..|
  Fly   243 YSELVKNTSLIFFASHAPSEGPIRPNVPAAIEIGGIQVKDTPDPLPQNMAEFL-GNATDGAILLS 306

  Fly   296 LGTNVRTKNMVDDRKRILIEAFGSLPQRVLWKFEDEELQDIP---SNVLVRKWLPQQDLLAHPKV 357
            ||:||:..::..|....:......|.|||:||:||  |:..|   .|:...|||||.|:||||.:
  Fly   307 LGSNVKGSHINPDTVVKMFNVLSKLKQRVIWKWED--LEKTPGKSDNIFYSKWLPQDDILAHPNI 369

  Fly   358 KLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTNVDHIKKHGFCLSLNYHDMTSDELKATILQLL 422
            ||||.|.|.....|:.::|||||.||.|.||..|.|.:.|.||.|:.:...:.....|..||::|
  Fly   370 KLFINHAGKGGITEAQYHGKPMLSLPVFGDQPGNADVMVKQGFGLTQSLLSLEEQPFKEAILEIL 434

  Fly   423 TEKRFEVTARIAGARYRDQPMKPLETAVWWTHYVLRHKGAPHMRVAGRKLSFFTHHSLDV--LGT 485
            :..::........:.|||:||...|:.::||.||:||.||.|::.....:||...:::|:  |..
  Fly   435 SNPQYFDKVASFSSLYRDRPMSARESVIYWTEYVIRHHGAAHLQSPLVHMSFIAANNIDIYALIA 499

  Fly   486 VLLVILLVIIAILLIIVFSVCKISKNISTRLVVKKQRKQK 525
            |:||||::::.:||..::           |.:..|.:|:|
  Fly   500 VVLVILVLLLKLLLQFIY-----------RKIFAKPKKEK 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 146/490 (30%)
UDPGT 33..484 CDD:278624 144/486 (30%)
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 151/506 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445719
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D53444at6656
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - otm14789
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48043
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
87.950

Return to query results.
Submit another query.