DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:402 Identity:117/402 - (29%)
Similarity:201/402 - (50%) Gaps:35/402 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DVFNNDGVRREILRPGK-AQFDLIIVDIWKYDAFYSLAAYFEAPIIGLA-PCG-IDWKIDEMVGN 170
            |:.|:...|::|:...| |.|||::.:...|.:...:....:..::.|| ..| :|:::..:   
  Rat    49 DLCNHLLSRKDIMEFLKNANFDLVLFESVDYCSSLIVEKLGKQFVLFLAFQLGFMDFELQRV--- 110

  Fly   171 PSPMSYLQSPSSYLYNLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKIAE-----TK 230
              |:||:....|.|.:...|.|||.:        |...:...:|...:..:|...|.|     ::
  Rat   111 --PLSYVPVYGSGLTDQMDFWGRVKN--------FLMFFDLSRKQREILSQYDSTIQEHFAEGSR 165

  Fly   231 P-LSEISQDIALVLVNQHFTLGPPRPYVPNVIEVGGMHIDEQPKALAQDLEDFIQGSGEHGVIYF 294
            | ||::.....|..||..|.....||..||::.|||: :|:..:::.||||:||...|:.|.:..
  Rat   166 PVLSDLLLKAELWFVNCDFAFEFARPLFPNIVYVGGL-LDKPVQSIPQDLENFITQFGDSGFVLV 229

  Fly   295 SLGTNVRTKNMVDDRKRILIEAFGSLPQRVLWKFEDEEL-QDI--PSNVLVRKWLPQQDLLAHPK 356
            :||| |.||....:..:.:..||..|||.|:|..:|... :|:  ..||.:..||||.||||||.
  Rat   230 ALGT-VATKFQTKEIIKEMNNAFAHLPQGVIWACKDSHWPKDVTLAPNVKIMDWLPQTDLLAHPS 293

  Fly   357 VKLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTNVDHIKKHGFCLSLNYHDMTSDELKATILQL 421
            ::||:|||||.|..|:|.:|.||:|:.||.||..|:..::.....:|:....:.::....|:.::
  Rat   294 IRLFVTHGGMNSVNEAIQHGVPMVGILFFSDQPENMIRVEAKTIGVSIQIQTLKAETFARTMKEV 358

  Fly   422 LTEKRFEVTARIAGARYRDQPMKPLETAVWWTHYVLRHKGAPHMRVAGRKLSFFTHHSLDV---- 482
            :.:||::..|..:.......|:.|.:....|..::|:..||.|::....:..:...:.|||    
  Rat   359 IEDKRYKSAAMASKIIRHSHPLTPSQRLEGWIDHILQTGGAAHLKPYAFQQPWHEQYLLDVFLFL 423

  Fly   483 ----LGTVLLVI 490
                ||||.|.:
  Rat   424 LGLTLGTVWLCV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 106/363 (29%)
UDPGT 33..484 CDD:278624 112/394 (28%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 110/384 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.