DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT1G64920

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_176672.1 Gene:AT1G64920 / 842800 AraportID:AT1G64920 Length:452 Species:Arabidopsis thaliana


Alignment Length:457 Identity:88/457 - (19%)
Similarity:145/457 - (31%) Gaps:177/457 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YTFGSSYLLITPFL---RNLVQRGHQLTL---------ISAVTIMPHIEGVHHIRVPKLDML--- 85
            :.||.    :||:|   ..|.::||::|.         :....:.||....|.:.:|.:|.|   
plant    13 FAFGH----MTPYLHLGNKLAEKGHRVTFLLPKKAQKQLEHQNLFPHGIVFHPLVIPHVDGLPAG 73

  Fly    86 --------------MKILLDFEYDT---------------DLTKWTEAQFLSEYFYNCSKFVLED 121
                          :.|.:|...|.               ||..|.                   
plant    74 AETASDIPISLVKFLSIAMDLTRDQIEAAIGALRPDLILFDLAHWV------------------- 119

  Fly   122 PGVQELLRNASAKYSLIILEASHNDALYGFSQHFNAPLLGVAAYGSSWNIDFLVGNSAPSVYEPM 186
            |.:.:.|:..|..|:::...:..:|.:.|..       ||||..|..         |:.::|...
plant   120 PEMAKALKVKSMLYNVMSATSIAHDLVPGGE-------LGVAPPGYP---------SSKALYREH 168

  Fly   187 SALGYTSGLNLIEKWHNLIYITEERLVERFIYLPRQIDLYKQHFPGATTSIHDLRRRFSLVLINQ 251
            .|             |.|:..:               ..||:.:           .||:..|:|.
plant   169 DA-------------HALLTFS---------------GFYKRFY-----------HRFTTGLMNC 194

  Fly   252 HFTMGR------------VRSNVPNIVEVAGMHLDE--KPYPLDAELKKILDEAEHGVIYFS--- 299
            .|...|            :.|.....|.:.|..|.|  |..||:.:....|.....|.:.|.   
plant   195 DFISIRTCEEIEGKFCDYIESQYKKKVLLTGPMLPEPDKSKPLEDQWSHWLSGFGQGSVVFCALG 259

  Fly   300 -------------------MGLQLLDHWLPPGMRASMSDAFAQLKQQ------VIWKTDYPEMVN 339
                               .||..|....||....::.:|..:..::      ::|    .|.|.
plant   260 SQTILEKNQFQELCLGIELTGLPFLVAVKPPKGANTIHEALPEGFEERVKGRGIVW----GEWVQ 320

  Fly   340 QSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRM-EKLG 403
            |.      :|.|  .||.||:|..|::|.|..|:.||:.....::.||:..||...|:.| |:|.
plant   321 QP------SWQP--LILAHPSVGCFVSHCGFGSMWESLMSDCQIVFIPVLNDQVLTTRVMTEELE 377

  Fly   404 VA 405
            |:
plant   378 VS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 88/457 (19%)
UDPGT 39..507 CDD:278624 87/454 (19%)
AT1G64920NP_176672.1 Glycosyltransferase_GTB-type 1..445 CDD:415824 88/457 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.