DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT74E2

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_172059.1 Gene:UGT74E2 / 837075 AraportID:AT1G05680 Length:453 Species:Arabidopsis thaliana


Alignment Length:462 Identity:105/462 - (22%)
Similarity:171/462 - (37%) Gaps:130/462 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SYLLITP------------FLRNLVQRGHQLTLI--------------SAVTIMPHIEGVHHIRV 79
            |:|::.|            |.:.|..:|.:|||:              .::|:.|...|......
plant     5 SHLIVLPFPGQGHITPMSQFCKRLASKGLKLTLVLVSDKPSPPYKTEHDSITVFPISNGFQEGEE 69

  Fly    80 P--KLDMLMKILLDFEYDTDLTKWTEAQFLSEYFYNCSKFVLEDPGVQELLRNASAKYSLIILEA 142
            |  .||..|: .::......|.|..|...||.   |..:.::.|..:..|            |:.
plant    70 PLQDLDDYME-RVETSIKNTLPKLVEDMKLSG---NPPRAIVYDSTMPWL------------LDV 118

  Fly   143 SHNDALYGFSQHFNAPLLGVAAYGSSWNIDFLV-----GNSA----PSVYEPMSALGYTSGLNLI 198
            :|:..|.| :..|..|.|..|.|...:...|.|     |:|.    || :..::|....|.|...
plant   119 AHSYGLSG-AVFFTQPWLVTAIYYHVFKGSFSVPSTKYGHSTLASFPS-FPMLTANDLPSFLCES 181

  Fly   199 EKWHNLIYITEERLVERFIYLPRQIDLYKQHFPGATTSIHDLRRRFSLVLINQHFTMGRVRSNVP 263
            ..:.|::.|..::|        ..||                  |..:||.|   |..::...:.
plant   182 SSYPNILRIVVDQL--------SNID------------------RVDIVLCN---TFDKLEEKLL 217

  Fly   264 NIVE-----------VAGMHLD-----EKPYPLD------AELKKILDEAE-HGVIYFSMG-LQL 304
            ..|:           |..|:||     :|.|...      ||..:.|:..| :.|:|.|.| |.:
plant   218 KWVQSLWPVLNIGPTVPSMYLDKRLSEDKNYGFSLFNAKVAECMEWLNSKEPNSVVYLSFGSLVI 282

  Fly   305 LDHWLPPGMRASMSDAFAQLKQQ---VIWKTDYPEMVNQSRNVFAR--------TWFPQRAILNH 358
            |       ....|.:..|.|||.   .:|.....|.....||....        :|.||..:|.|
plant   283 L-------KEDQMLELAAGLKQSGRFFLWVVRETETHKLPRNYVEEIGEKGLIVSWSPQLDVLAH 340

  Fly   359 PNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRME---KLGVARKLDFKNLF-RDEIV 419
            .::..|:||.|..|.:|.:...||::.:|.:.||..|.|.|:   |:||..|.:..... |:||:
plant   341 KSIGCFLTHCGWNSTLEGLSLGVPMIGMPHWTDQPTNAKFMQDVWKVGVRVKAEGDGFVRREEIM 405

  Fly   420 LAIEDLV 426
            .::|:::
plant   406 RSVEEVM 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 105/462 (23%)
UDPGT 39..507 CDD:278624 105/462 (23%)
UGT74E2NP_172059.1 Glycosyltransferase_GTB-type 6..450 CDD:415824 104/461 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.