DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT75B2

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_172044.1 Gene:UGT75B2 / 837055 AraportID:AT1G05530 Length:455 Species:Arabidopsis thaliana


Alignment Length:493 Identity:98/493 - (19%)
Similarity:157/493 - (31%) Gaps:180/493 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LCPKLTNAENI-LAVFSYTFGSSYLLITPFLRNLV------------------QRGHQLTLISAV 65
            :.|...|.||: ...||..|....:..|..::|.:                  |.|.........
plant    48 MIPNHNNVENLSFLTFSDGFDDGVISNTDDVQNRLVHFERNGDKALSDFIEANQNGDSPVSCLIY 112

  Fly    66 TIMP----------HIEGVHHIRVPKLDMLMKILLDFEYDTDLTKWTEAQFLSEYFYNCS---KF 117
            ||:|          |:..||                        .|.:..|..:.:||.|   ..
plant   113 TILPNWVPKVARRFHLPSVH------------------------LWIQPAFAFDIYYNYSTGNNS 153

  Fly   118 VLEDPGVQEL-LRNASAKYSLIILEASHNDALYGFSQHFNAPLLGVAAYGSSWNIDFLVGNSAPS 181
            |.|.|.:..| :|:                 |..|....|......|.|...  :|||...|.|.
plant   154 VFEFPNLPSLEIRD-----------------LPSFLSPSNTNKAAQAVYQEL--MDFLKEESNPK 199

  Fly   182 VYEPMSALGYTSGLNLIEKWHNL--IYITEERLVERFI---YLPRQI--------DLYKQHFPGA 233
            :              |:..:.:|  .::|....:|...   .||.:|        ||.:.|...:
plant   200 I--------------LVNTFDSLEPEFLTAIPNIEMVAVGPLLPAEIFTGSESGKDLSRDHQSSS 250

  Fly   234 TTSIHDLRRRFSLVLINQHFTMGRVRSNVPNIVEVAGMHLDE---------KPY------PLDAE 283
            .|...|.:...|::.:           :...:||::...::|         :|:      .|:.|
plant   251 YTLWLDSKTESSVIYV-----------SFGTMVELSKKQIEELARALIEGGRPFLWVITDKLNRE 304

  Fly   284 LKKILDEAEHGVIYFSMGLQLLDHWLPP-GMRASMSDAFAQLKQQVIWKTDYPEMVNQSRNVFAR 347
            .|  ::..|...|....|.:   |.|.. ||..|                               
plant   305 AK--IEGEEETEIEKIAGFR---HELEEVGMIVS------------------------------- 333

  Fly   348 TWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRME---KLGVARKLD 409
             |..|..:|.|..:..|:||.|..|.:||:...||::..|::.||..|.|.:|   |.||..:.:
plant   334 -WCSQIEVLRHRAIGCFLTHCGWSSSLESLVLGVPVVAFPMWSDQPANAKLLEEIWKTGVRVREN 397

  Fly   410 FKNLF-RDEIVLAIE--------DLVYNA-SYKRNARD 437
            .:.|. |.||:..:|        :|..|| .:||.|.:
plant   398 SEGLVERGEIMRCLEAVMEAKSVELRENAEKWKRLATE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 97/487 (20%)
UDPGT 39..507 CDD:278624 91/473 (19%)
UGT75B2NP_172044.1 PLN02152 1..455 CDD:177813 98/493 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.