DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT5G54010

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_200212.1 Gene:AT5G54010 / 835484 AraportID:AT5G54010 Length:453 Species:Arabidopsis thaliana


Alignment Length:210 Identity:48/210 - (22%)
Similarity:84/210 - (40%) Gaps:47/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 PLDAELKKILDEAEHG-VIYFSMGLQLL---DHW------------------LPPGMRASMSDAF 321
            ||:.:.::.|.:.:.| |||.::|.|::   |.:                  .||...:::.:|.
plant   242 PLEDQWRQWLSKFDPGSVIYCALGSQIILEKDQFQELCLGMELTGLPFLVAVKPPKGSSTIQEAL 306

  Fly   322 AQLKQQVIWKTDYPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCI 386
            .:         .:.|.| ::|.|....|..|..||.||::..|::|.|..|:.|::.....::.|
plant   307 PK---------GFEERV-KARGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWEALVNDCQIVFI 361

  Fly   387 PLFYDQFQNTKRME---KLGVARKLDFKNLFRDEIVLAIEDLVYNASYKRNARDLSQRFHDQPMS 448
            |...:|..||:.|.   |:.|..|.:....|..|            |.....|.:..|..:....
plant   362 PHLGEQILNTRLMSEELKVSVEVKREETGWFSKE------------SLSGAVRSVMDRDSELGNW 414

  Fly   449 AMDTAIWWTEYILRH 463
            |....:.|.|.:|||
plant   415 ARRNHVKWKESLLRH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 48/210 (23%)
UDPGT 39..507 CDD:278624 48/210 (23%)
AT5G54010NP_200212.1 Glycosyltransferase_GTB_type 1..451 CDD:299143 48/210 (23%)
MGT 8..409 CDD:273616 42/188 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.