DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT5G38040

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_198620.1 Gene:AT5G38040 / 833784 AraportID:AT5G38040 Length:449 Species:Arabidopsis thaliana


Alignment Length:457 Identity:103/457 - (22%)
Similarity:167/457 - (36%) Gaps:111/457 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ITPFL---RNLVQRGHQLTLISAVTIMPHIEGVHHIRVPKLDMLMKILLDFEYDT--------DL 98
            |||.:   :.|..:|..:|::.  |...::.       |..|     |.||::.|        ||
plant    22 ITPMIQLAKALHSKGFSITVVQ--TKFNYLN-------PSND-----LSDFQFVTIPENLPVSDL 72

  Fly    99 TKWTEAQFLSEYFYNCSKFVLEDPGVQELLRNASAKYSLIILEASHNDALYGFSQHFNAPLLGVA 163
            ......:||.:....|  :|.....:.:||.|...:.:.:|    :::.:|         .:.||
plant    73 KNLGPGRFLIKLANEC--YVSFKDLLGQLLVNEEEEIACVI----YDEFMY---------FVEVA 122

  Fly   164 AYGSSWNIDFLVGNSAPSVYEPMSALGYTSGLNLIEKW--HNLIYITE--ERLVERF--IYLPRQ 222
            ..      :|.:.|   .:....||..:.....:.|.:  ..|..:.|  ||.||..  :|..|.
plant   123 VK------EFKLRN---VILSTTSATAFVCRFVMCELYAKDGLAQLKEGGEREVELVPELYPIRY 178

  Fly   223 IDLYKQHFPGATTSIHDLRR-----RFSLVLINQHFTMGRVRSNVPNIVEVAGMHLDEKPY---P 279
            .||....|....:|:...:.     ..|.|:||      .||....:.:|.....|:...|   |
plant   179 KDLPSSVFASVESSVELFKNTCYKGTASSVIIN------TVRCLEMSSLEWLQQELEIPVYSIGP 237

  Fly   280 L----DAELKKILDEAE-----------HGVIYFSMGLQLLDHWLPPGMRASMSDAFAQLKQQVI 329
            |    .|....:|:|.|           ..|||.|:|...|   :.......|:..|....|..:
plant   238 LHMVVSAPPTSLLEENESCIEWLNKQKPSSVIYISLGSFTL---METKEMLEMAYGFVSSNQHFL 299

  Fly   330 W--------------KTDYPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYA 380
            |              :....:||...|....: |.||:.:|.|..|..|.:|.|..|.:||:...
plant   300 WVIRPGSICGSEISEEELLKKMVITDRGYIVK-WAPQKQVLAHSAVGAFWSHCGWNSTLESLGEG 363

  Fly   381 VPLLCIPLFYDQFQNTKRME---KLGVARKLDFKNLFRDEIVLAIEDLVYN---ASYKRNARDLS 439
            |||:|.|...||..|.:.:|   |:|:..:   ..|.|..|..|::.|:.:   ...||.|..|.
plant   364 VPLICRPFTTDQKGNARYLECVWKVGIQVE---GELERGAIERAVKRLMVDEEGEEMKRRALSLK 425

  Fly   440 QR 441
            ::
plant   426 EK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 103/457 (23%)
UDPGT 39..507 CDD:278624 103/457 (23%)
AT5G38040NP_198620.1 Glycosyltransferase_GTB-type 1..446 CDD:415824 103/457 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.