DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:356 Identity:67/356 - (18%)
Similarity:118/356 - (33%) Gaps:99/356 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KILLDFEYDT--------DLTKWTEAQFLSEYFYNC--------SKFVLEDPGVQELLRNASAKY 135
            |.|.||::.|        ||.......|:.:....|        .:|:|:.   ||.:.......
plant    29 KDLADFQFITIPESLPASDLKTLGPIWFIIKLNKECEISFKKCLGQFLLQQ---QEEIACVIYDE 90

  Fly   136 SLIILEASHNDALYGFSQHFNAPLLGVAAYGSSWNIDFLVGNSAPSVYEPMSALGYTSGL----N 196
            .:...||:        ::.||.|.:   .:.:.....|...::...:|........|.|.    .
plant    91 FMYFAEAA--------AKEFNLPKV---IFSTENATAFACRSAMCKLYAKDGIAPLTEGCGREEE 144

  Fly   197 LIEKWHNLIYITEERLVERFIYLPRQIDLYKQHFPGATTSIHDLRRRFSLVLINQHFTMGRVRSN 261
            |:.:.|.|.|  ::.....|..:...::::|......|.|        |:::            |
plant   145 LVPELHPLRY--KDLPTSAFAPVEASVEVFKSSCEKGTAS--------SMII------------N 187

  Fly   262 VPNIVEVAGM-----HLDEKPYPL-------DAELKKILDEAE-----------HGVIYFSMGLQ 303
            ..:.:|::.:     .|....||:       .|....:|||.|           ..|||.|:|..
plant   188 TVSCLEISSLEWLQQELKIPIYPIGPLYMVSSAPPTSLLDENESCIDWLNKQKPSSVIYISLGSF 252

  Fly   304 LLDHWLPPGMRASMSDAFAQLKQQVIWKTDYP------EMVNQ---------SRNVFARTWFPQR 353
            .|   |.......|:.......|..:|.. .|      |:.|:         .|....: |..|:
plant   253 TL---LETKEVLEMASGLVSSNQYFLWAI-RPGSILGSELSNEELFSMMEIPDRGYIVK-WATQK 312

  Fly   354 AILNHPNVKLFITHAGLLSLIESVHYAVPLL 384
            .:|.|..|..|.:|.|..|.:||:...:|::
plant   313 QVLAHAAVGAFWSHCGWNSTLESIGEGIPIV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 67/356 (19%)
UDPGT 39..507 CDD:278624 67/356 (19%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 67/354 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.