DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT72E3

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_198003.1 Gene:UGT72E3 / 832700 AraportID:AT5G26310 Length:481 Species:Arabidopsis thaliana


Alignment Length:464 Identity:94/464 - (20%)
Similarity:177/464 - (38%) Gaps:122/464 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSGPGIAGLLLTVLLFGLLCPKLTNAENILAVFSYTFGSSYLLITPFLRNLVQRGHQLTLISAV 65
            |||.||:          |.:.|.:..|:.:.|...:.       :|.|:........|..|:::.
plant    10 MFSSPGM----------GHVLPVIELAKRLSANHGFH-------VTVFVLETDAASVQSKLLNST 57

  Fly    66 TI------MPHIEGV----HHIRVPKLDMLMKILLDFEYDTDLTKWTEAQFLSEYFYNCSKFVLE 120
            .:      .|.|.|:    .|: |.|:.::|:         :......::.::.: .|.:..:::
plant    58 GVDIVNLPSPDISGLVDPNAHV-VTKIGVIMR---------EAVPTLRSKIVAMH-QNPTALIID 111

  Fly   121 DPGVQELLRNASAKYSLIILEASHNDALYGFSQHFNAPLLGVAAYGSSWNIDFLVGNSAPSVYEP 185
            ..|...|...|.......:..||            ||..|||:.|..:  :|.::........:|
plant   112 LFGTDALCLAAELNMLTYVFIAS------------NARYLGVSIYYPT--LDEVIKEEHTVQRKP 162

  Fly   186 MSALGYTSGLNLIEKWHNLI--YITEER-----LVERFIYLPRQ----IDLYKQHFPGATTSIHD 239
            ::..|...     .::.:::  |:..:.     ||...:..|:.    ::.:::..|.:..|:.|
plant   163 LTIPGCEP-----VRFEDIMDAYLVPDEPVYHDLVRHCLAYPKADGILVNTWEEMEPKSLKSLQD 222

  Fly   240 LRRRFSLVLINQHFTMGRVRSNVPNIVEVAG-----MHLDEKPYPLDAELKKILDEAEHGVIYFS 299
            .:            .:||| :.||  |...|     :......:|:...|.|   :....|:|.|
plant   223 PK------------LLGRV-ARVP--VYPVGPLCRPIQSSTTDHPVFDWLNK---QPNESVLYIS 269

  Fly   300 MG-------LQLLD------------HWL--PPGMRASMSDAFAQLKQQVIWKTDYPEMVNQ--- 340
            .|       .||.:            .|:  ||...:|.||.|:  .:..:.|.:.||.:.:   
plant   270 FGSGGSLTAQQLTELAWGLEESQQRFIWVVRPPVDGSSCSDYFS--AKGGVTKDNTPEYLPEGFV 332

  Fly   341 ----SRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRM-E 400
                .|.....:|.||..||.|..|..|:||.|..|.:|||...||::..|||.:|..|...: :
plant   333 TRTCDRGFMIPSWAPQAEILAHQAVGGFLTHCGWSSTLESVLCGVPMIAWPLFAEQNMNAALLSD 397

  Fly   401 KLGVARKLD 409
            :||::.::|
plant   398 ELGISVRVD 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 87/439 (20%)
UDPGT 39..507 CDD:278624 85/426 (20%)
UGT72E3NP_198003.1 PLN02992 1..481 CDD:178572 94/464 (20%)
YjiC 5..442 CDD:224732 94/464 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.