DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:338 Identity:78/338 - (23%)
Similarity:129/338 - (38%) Gaps:70/338 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 DALYGFSQHFNAPLLGVAAYGSSWNIDFLVGNSAPSVY----------------EPM-SALGYTS 193
            ||.:.|:......:      .:||...:..|.::.|.:                |.| ..:|..|
plant   123 DAFFWFAADMATEI------NASWIAFWTAGANSLSAHLYTDLIRETIGVKEVGERMEETIGVIS 181

  Fly   194 GLNLIE--------KWHNLIYITEERLVERFIYLPRQIDLYKQHFPGA-TTSIHDLRRRFSLVLI 249
            |:..|.        .:.||..:..:.|.:..:.|||...::...|... .|..::||.||...| 
plant   182 GMEKIRVKDTPEGVVFGNLDSVFSKMLHQMGLALPRATAVFINSFEDLDPTLTNNLRSRFKRYL- 245

  Fly   250 NQHFTMGRVRSNVPNIVEVAGMHLDEKPYPLDAELKKILDEAEHGVIYFSMGLQLLDHWLPPGMR 314
             ....:|.:.|.:..:|        :.|:...|.::|   .:...|.|.|.|..:..   |||..
plant   246 -NIGPLGLLSSTLQQLV--------QDPHGCLAWMEK---RSSGSVAYISFGTVMTP---PPGEL 295

  Fly   315 ASMSDAFAQLKQQVIWKTDYPEMVNQSRNVFART--------WFPQRAILNHPNVKLFITHAGLL 371
            |::::.....|...:|......:|...:....||        |.||..:|.|....:|:||.|..
plant   296 AAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTREQGIVVPWAPQVELLKHEATGVFVTHCGWN 360

  Fly   372 SLIESVHYAVPLLCIPLFYDQFQNTKRMEKL---------GVARKLDFKNLFRDEIVLAIEDLVY 427
            |::|||...||::|.|.|.||..|.:.:|.:         ||..|..|:...  :.||..:|   
plant   361 SVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTIINGVFTKDGFEKCL--DKVLVQDD--- 420

  Fly   428 NASYKRNARDLSQ 440
            ....|.||:.|.:
plant   421 GKKMKCNAKKLKE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 78/338 (23%)
UDPGT 39..507 CDD:278624 78/338 (23%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 78/338 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.