DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:283 Identity:65/283 - (22%)
Similarity:111/283 - (39%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 LGYTSGLNLIE--------KWHNLIYITEERLVERFIYLPRQIDLYKQHFPGA-TTSIHDLRRRF 244
            :|:.||:..|.        .:.||..:..:.|.:..:.|||...::...|... .|..:|.|..|
plant   174 IGFISGMEKIRVKDTQEGVVFGNLDSVFSKTLHQMGLALPRATAVFINSFEELDPTFTNDFRSEF 238

  Fly   245 SLVLINQHFTMGRVRSNVPNIVEVAGMH-------LDEKPYPLDAELKKILDEAEHGVIYFSMGL 302
            ...|               ||..:|.:.       |...|:...|.::|   .:...|.|.:.|.
plant   239 KRYL---------------NIGPLALLSSPSQTSTLVHDPHGCLAWIEK---RSTASVAYIAFGR 285

  Fly   303 QLLDHWLPPGMRASMSDAFAQLKQQVIWKTDYPEMVNQSRNVFART--------WFPQRAILNHP 359
            ....   ||....:::......|...:|.....:|.:.......||        |.||..:|||.
plant   286 VATP---PPVELVAIAQGLESSKVPFVWSLQEMKMTHLPEGFLDRTREQGMVVPWAPQVELLNHE 347

  Fly   360 NVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRME---KLGV--ARKLDFKNLFRDEI- 418
            .:.:|::|.|..|::|||...||::|.|:|.|...|.:.:|   ::||  :..:..|:.|.:.: 
plant   348 AMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHAINARSVEAVWEIGVTISSGVFTKDGFEESLD 412

  Fly   419 -VLAIEDLVYNASYKRNARDLSQ 440
             ||..:|   ....|.||:.|.:
plant   413 RVLVQDD---GKKMKVNAKKLEE 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 65/283 (23%)
UDPGT 39..507 CDD:278624 65/283 (23%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 65/283 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.