DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT5G05900

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_196209.1 Gene:AT5G05900 / 830475 AraportID:AT5G05900 Length:450 Species:Arabidopsis thaliana


Alignment Length:428 Identity:90/428 - (21%)
Similarity:152/428 - (35%) Gaps:122/428 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GLLLTVLLFGLLCPKLTNAENILAVFSYTFGSSYLLITPFLRNLVQRGHQLTLISAVTIMPHIEG 73
            |..:||:......||.:|..      .:||    |.|...|.....|.|.:||:  :|::.    
plant    34 GFSITVIHTRFNAPKASNHP------LFTF----LQIPDGLSETETRTHDITLL--LTLLN---- 82

  Fly    74 VHHIRVPKLDMLMKILLDFEYDTDLTKWTEAQFLSEYFYNCSKFVLEDPG---VQELLRNASAKY 135
             .....|..:.|.|:|...:.:|.    .|.|.:|     |   :::|.|   .|.:        
plant    83 -RSCESPFRECLTKLLQSADSETG----EEKQRIS-----C---LIDDSGWIFTQPV-------- 126

  Fly   136 SLIILEASHNDALYGFSQHFNAPLLGVAAYGSSWNID-FLVGNSAPSVYEPMSALGYTSGLNLIE 199
                            :|.||.|.|.:..|..|:..| |::......:|.|:.  ....|.:.:|
plant   127 ----------------AQSFNLPRLVLNTYKVSFFRDHFVLPQLRREMYLPLQ--DSEQGDDPVE 173

  Fly   200 KW-----HNLIYITEERLVERFIYLPRQIDLYKQHFPGAT-----------------TSIHDLRR 242
            ::     .:|:.|.::.        ..|:|.|.......|                 .|:...|.
plant   174 EFPPLRKKDLLQILDQE--------SEQLDSYSNMILETTKASSGLIFVSTCEELDQDSLSQARE 230

  Fly   243 RFSLVLINQHFTMGRVRSNVPNIVEVAGMHLDEKPYPLDAELKKILDEAE-HGVIYFSMG-LQLL 305
            .:.:.:    ||:|...|..|.        .....:.:|......||:.| ..|||.|.| :..:
plant   231 DYQVPI----FTIGPSHSYFPG--------SSSSLFTVDETCIPWLDKQEDKSVIYVSFGSISTI 283

  Fly   306 DHWLPPGMRASMSDAFA--QLKQQVIW---------KTDYPEMVNQSRNVFARTWFPQRAILNHP 359
                  |....|..|:|  ...|..:|         ..::.|.:::...:.  .|.||:.:|.|.
plant   284 ------GEAEFMEIAWALRNSDQPFLWVVRGGSVVHGAEWIEQLHEKGKIV--NWAPQQEVLKHQ 340

  Fly   360 NVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTK 397
            .:..|:||.|..|.:|||...||::|:|..:||..|.:
plant   341 AIGGFLTHNGWNSTVESVFEGVPMICMPFVWDQLLNAR 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 85/411 (21%)
UDPGT 39..507 CDD:278624 82/398 (21%)
AT5G05900NP_196209.1 Glycosyltransferase_GTB_type 2..447 CDD:299143 90/428 (21%)
YjiC 8..436 CDD:224732 90/428 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.