DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT5G05880

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_196207.1 Gene:AT5G05880 / 830473 AraportID:AT5G05880 Length:451 Species:Arabidopsis thaliana


Alignment Length:385 Identity:89/385 - (23%)
Similarity:140/385 - (36%) Gaps:131/385 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NCSKFVLEDPGVQELLRN--ASAKYSLIILEASHNDALYGFSQHFNAPLLGVAAYGSSWNIDFL- 174
            ||     |.| |:|.||.  .|||.....:....||:.:.|:||....|..:....:::.|.|. 
plant    84 NC-----ESP-VRECLRKLLQSAKEEKQRISCLINDSGWIFTQHLAKSLNLMRLAFNTYKISFFR 142

  Fly   175 ------------------------VGNSAP-------SVYEPMSALGYTSGLNLIEKW---HNLI 205
                                    |....|       .:.|..|..|.:....::||.   ..||
plant   143 SHFVLPQLRREMFLPLQDSEQDDPVEKFPPLRKKDLLRILEADSVQGDSYSDMILEKTKASSGLI 207

  Fly   206 YITEERLVERFIYLPRQ--------IDLYKQHFPGATTSIHDLRRRFSLVLINQHFTMGRVRSNV 262
            :::.|.|.:..:...|:        |.....|||.:::|:               ||.       
plant   208 FMSCEELDQDSLSQSREDFKVPIFAIGPSHSHFPASSSSL---------------FTP------- 250

  Fly   263 PNIVEVAGMHLDEKPYP-LDAELKKILDEAEHGVIYFSMG-------LQLLD-HWLPPGMRASMS 318
                       ||...| ||.:..|       .|||.|:|       .:|:: .|   |:  |.|
plant   251 -----------DETCIPWLDRQEDK-------SVIYVSIGSLVTINETELMEIAW---GL--SNS 292

  Fly   319 DAFAQLKQQVIW--------KTDYPEMV--------NQSRNVFARTWFPQRAILNHPNVKLFITH 367
            |      |..:|        .|::.|.:        |:...:.  .|.||:.:|.|..:..|:||
plant   293 D------QPFLWVVRVGSVNGTEWIEAIPEYFIKRLNEKGKIV--KWAPQQEVLKHRAIGGFLTH 349

  Fly   368 AGLLSLIESVHYAVPLLCIPLFYDQFQNTKRMEKLG-VARKLDFKNLFRDEIVLAIEDLV 426
            .|..|.:|||...||::|:|..:||..|.:.:..:. |...|:.: :.||||..||..|:
plant   350 NGWNSTVESVCEGVPMICLPFRWDQLLNARFVSDVWMVGIHLEGR-IERDEIERAIRRLL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 89/385 (23%)
UDPGT 39..507 CDD:278624 89/385 (23%)
AT5G05880NP_196207.1 Glycosyltransferase_GTB-type 2..451 CDD:385653 89/385 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.