DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT76C1

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:492 Identity:95/492 - (19%)
Similarity:160/492 - (32%) Gaps:208/492 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ITPFL---RNLVQRGHQLTLISA------------VTIMPHIEGVHHIRVPKLDMLMKILLDFEY 94
            |.|.|   :.|..||..:|:|..            .|.:...:|:...:....|:|:::.|    
plant    20 INPMLQLAKILYSRGFSITIIHTRFNAPKSSDHPLFTFLQIRDGLSESQTQSRDLLLQLTL---- 80

  Fly    95 DTDLTKWTEAQFLSEYFYNC--------SKFV--LEDPGVQELLRNASAKYSLIILEASHNDALY 149
                        |:.   ||        :|.:  ..|.|.::      .|.|.:|     :|:.:
plant    81 ------------LNN---NCQIPFRECLAKLIKPSSDSGTED------RKISCVI-----DDSGW 119

  Fly   150 GFSQ----HFNAPLLGVAAYGSSWNIDFLVGNSAPSVYEPMSALGYTSGLNLIEKWHNLIYITEE 210
            .|:|    .||.|...:.||    ...|.:|:                            ::..:
plant   120 VFTQSVAESFNLPRFVLCAY----KFSFFLGH----------------------------FLVPQ 152

  Fly   211 RLVERFIYLP-RQIDLYKQHFPGATTSIHDLRRRFSLVLINQHFTMGRVRSNVPNIVEVAGMHLD 274
            ...|.|:.:| .:.|.....||       .||::                    ::..:.|....
plant   153 IRREGFLPVPDSEADDLVPEFP-------PLRKK--------------------DLSRIMGTSAQ 190

  Fly   275 EKPYPLDAELKKILDEAE--HGVIYFSMGLQLLDH------------------------------ 307
            .|  ||||.|.||||..:  .|:|.  |..:.|||                              
plant   191 SK--PLDAYLLKILDATKPASGIIV--MSCKELDHDSLAESNKVFSIPIFPIGPFHIHDVPASSS 251

  Fly   308 -----------WLPPGMRASMSDAFAQLKQ-QVIWKTDYPEM------VNQS-------RNVFAR 347
                       ||  .||.:.|..:..|.. ..:.::|:.|:      .|||       .:|..|
plant   252 SLLEPDQSCIPWL--DMRETRSVVYVSLGSIASLNESDFLEIACGLRNTNQSFLWVVRPGSVHGR 314

  Fly   348 TWF---------------------PQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYD 391
            .|.                     ||..:|.|.....|:||.|..|.:||:...||::|:|..:|
plant   315 DWIESLPSGFMESLDGKGKIVRWAPQLDVLAHRATGGFLTHNGWNSTLESICEGVPMICLPCKWD 379

  Fly   392 QFQNTK---RMEKLGV--ARKLDFKNLFRDEIVLAIE 423
            ||.|.:   .:.::|:  ..:::.:.:.|..|.|.:|
plant   380 QFVNARFISEVWRVGIHLEGRIERREIERAVIRLMVE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 95/492 (19%)
UDPGT 39..507 CDD:278624 95/492 (19%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 95/492 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.