DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT76C2

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_196205.1 Gene:UGT76C2 / 830471 AraportID:AT5G05860 Length:450 Species:Arabidopsis thaliana


Alignment Length:464 Identity:97/464 - (20%)
Similarity:172/464 - (37%) Gaps:147/464 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GIAGLLLTVLLFGLLCPKLTNAENILAV--FSYTF---------GSSYLLITPFLR-------NL 52
            |:..:|..:.|.|.:.|.|..| |||.|  ||.|.         .||:.|.| ||:       ..
plant     7 GLRVILFPLPLQGCINPMLQLA-NILHVRGFSITVIHTRFNAPKASSHPLFT-FLQIPDGLSETE 69

  Fly    53 VQRGHQLTLISAVTIMPHIEGVHHIRVPKLDMLMKILLDFEYDTDLT------KWTEAQFLSE-- 109
            :|.| .::|::.:.:        :...|..|.|.|:||:.:....:|      .|...|.:||  
plant    70 IQDG-VMSLLAQINL--------NAESPFRDCLRKVLLESKESERVTCLIDDCGWLFTQSVSESL 125

  Fly   110 ------------YFYNCSKFVLEDPGVQELLRNASAKYSLIILEASHNDALYGFSQHFNAPLLGV 162
                        .|:|..      |.: .|:|   .|..|.:.|:...|::..|.......|..|
plant   126 KLPRLVLCTFKATFFNAY------PSL-PLIR---TKGYLPVSESEAEDSVPEFPPLQKRDLSKV 180

  Fly   163 -AAYGSSWNIDFLVGNSAPSVYEPMSALGYTSGLNLIEKWHNLIYITEERLVERFIYLPRQ---- 222
             ..:|...:         |.::..:.....:||         |||::.|.|.:..:.|..:    
plant   181 FGEFGEKLD---------PFLHAVVETTIRSSG---------LIYMSCEELEKDSLTLSNEIFKV 227

  Fly   223 ----IDLYKQHFPGATTSIHDLRRRFSLVLINQ------HFTMGRVRSNVPNIVE------VAGM 271
                |..:..:|..:::|:........|.|.:|      :.::|    :|.||.|      ..|:
plant   228 PVFAIGPFHSYFSASSSSLFTQDETCILWLDDQEDKSVIYVSLG----SVVNITETEFLEIACGL 288

  Fly   272 HLDEKPYPLDAELKKILDEAEHGVIYFSMGLQLLDHWLPP---GMRASMSDAFAQLKQQVIWKTD 333
            ...::|:                :.....|..|...|:.|   |:.:|:.:     |.:::    
plant   289 SNSKQPF----------------LWVVRPGSVLGAKWIEPLSEGLVSSLEE-----KGKIV---- 328

  Fly   334 YPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKR 398
                          .|.||:.:|.|.....|:||.|..|.:||:...||::|:|..:||..|::.
plant   329 --------------KWAPQQEVLAHRATGGFLTHNGWNSTLESICEGVPMICLPGGWDQMLNSRF 379

  Fly   399 ME---KLGV 404
            :.   |:|:
plant   380 VSDIWKIGI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 91/444 (20%)
UDPGT 39..507 CDD:278624 83/420 (20%)
UGT76C2NP_196205.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 97/464 (21%)
YjiC 9..429 CDD:224732 96/462 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.