DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT4G36770

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_195395.4 Gene:AT4G36770 / 829830 AraportID:AT4G36770 Length:457 Species:Arabidopsis thaliana


Alignment Length:221 Identity:53/221 - (23%)
Similarity:96/221 - (43%) Gaps:41/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 MGRVRSNVPNIVEVAGMHLDEKPYPLDAELKK-ILD----EAEHGVIYFSM-------------- 300
            :|||...|| :..|..:     ..|.:..||. :||    :.:..|:|.|.              
plant   226 LGRVMRGVP-VYPVGPL-----VRPAEPGLKHGVLDWLDLQPKESVVYVSFGSGGALTFEQTNEL 284

  Fly   301 --GLQLLDH---WL--PPGMRASMSDAFAQLKQQVIWKTDYPE-MVNQSRNV--FARTWFPQRAI 355
              ||:|..|   |:  ||......:..|.:.|.:.......|. .:::::::  ..|||.||..|
plant   285 AYGLELTGHRFVWVVRPPAEDDPSASMFDKTKNETEPLDFLPNGFLDRTKDIGLVVRTWAPQEEI 349

  Fly   356 LNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRME-KLGVARKLD-----FKNLF 414
            |.|.:...|:||.|..|::||:...||::..||:.:|..|.:.:. :|.:|.:::     .|...
plant   350 LAHKSTGGFVTHCGWNSVLESIVNGVPMVAWPLYSEQKMNARMVSGELKIALQINVADGIVKKEV 414

  Fly   415 RDEIVLAIEDLVYNASYKRNARDLSQ 440
            ..|:|..:.|.......::|.::|.:
plant   415 IAEMVKRVMDEEEGKEMRKNVKELKK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 53/221 (24%)
UDPGT 39..507 CDD:278624 53/221 (24%)
AT4G36770NP_195395.4 Glycosyltransferase_GTB_type 4..448 CDD:299143 53/221 (24%)
YjiC 6..451 CDD:224732 53/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.