DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT73B1

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_567955.1 Gene:UGT73B1 / 829561 AraportID:AT4G34138 Length:488 Species:Arabidopsis thaliana


Alignment Length:515 Identity:110/515 - (21%)
Similarity:191/515 - (37%) Gaps:156/515 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLTVLLFGLLCPKLTNAENILAVFSYTFGSSYLLITP-----FLRNLVQRGHQLTL-ISAVTI- 67
            ||...:..|.:.|.|..|:    :|:.....|.:|.||     |....::..:|... :..:|| 
plant    13 LLFPFMAHGHMIPTLDMAK----LFATKGAKSTILTTPLNAKLFFEKPIKSFNQDNPGLEDITIQ 73

  Fly    68 ----------MPHIEGVHH----IRVPKL---DMLMKILLDFEYDTD-----LTKWTEAQFLSEY 110
                      :|  :|..:    ...|.|   |:..|.||..:|..:     |........:...
plant    74 ILNFPCTELGLP--DGCENTDFIFSTPDLNVGDLSQKFLLAMKYFEEPLEELLVTMRPDCLVGNM 136

  Fly   111 FYNCSKFVLEDPGVQELLRNASAKYSLIILEASHNDALYGFSQHFNAPLLGVAAYGSSWNIDFLV 175
            |:..|..|.|..||..|:.:.:..:||.   |||...|         | ..||.....:.|..|.
plant   137 FFPWSTKVAEKFGVPRLVFHGTGYFSLC---ASHCIRL---------P-KNVATSSEPFVIPDLP 188

  Fly   176 GNSAPSVYEPMSALGYTSGLNLIEKWHNLIYITEERLVE--------RFIYLPRQIDLYKQHFPG 232
            |:                           |.||||:::|        ||:               
plant   189 GD---------------------------ILITEEQVMETEEESVMGRFM--------------- 211

  Fly   233 ATTSIHDLRRRFSLVLINQHFTMGRVRSN-VPNIVEVAGMHLDEKPYPLDAELKKILDEAEHG-- 294
              .:|.|..|....||:|..:.:.:..|: ..:.|.....|:.    ||....:|..::||.|  
plant   212 --KAIRDSERDSFGVLVNSFYELEQAYSDYFKSFVAKRAWHIG----PLSLGNRKFEEKAERGKK 270

  Fly   295 -------------------VIYFSMGL-------QLLDHWLPPGMRASMSDAF-------AQLKQ 326
                               |||.:.|.       ||::  :..|:..|..|..       :|:::
plant   271 ASIDEHECLKWLDSKKCDSVIYMAFGTMSSFKNEQLIE--IAAGLDMSGHDFVWVVNRKGSQVEK 333

  Fly   327 QVIWKTDYPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYD 391
            : .|..:..|...:.:.:..|.|.||..||.|..:..|:||.|..||:|.|...:|::..|:..:
plant   334 E-DWLPEGFEEKTKGKGLIIRGWAPQVLILEHKAIGGFLTHCGWNSLLEGVAAGLPMVTWPVGAE 397

  Fly   392 QFQNTK---RMEKLGVA---RKL-----DFKNLFRDEIVLAIEDLVYNASYKRNARDLSQ 440
            ||.|.|   ::.|.||:   :|:     ||  :.|:::..|:.:::.....::.|::|::
plant   398 QFYNEKLVTQVLKTGVSVGVKKMMQVVGDF--ISREKVEGAVREVMVGEERRKRAKELAE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 105/499 (21%)
UDPGT 39..507 CDD:278624 103/486 (21%)
UGT73B1NP_567955.1 PLN03007 5..482 CDD:178584 110/515 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.