DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT4G27570

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_194487.1 Gene:AT4G27570 / 828866 AraportID:AT4G27570 Length:453 Species:Arabidopsis thaliana


Alignment Length:443 Identity:92/443 - (20%)
Similarity:155/443 - (34%) Gaps:142/443 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ITPFL---RNLVQRGHQLTLI---------------------SAVTIMPHIEGV-------HHIR 78
            :||||   ..|.::||.:|.:                     .:||: ||::|:       ..|.
plant    19 MTPFLFLANKLAEKGHTVTFLLPKKSLKQLEHFNLFPHNIVFRSVTV-PHVDGLPVGTETASEIP 82

  Fly    79 VPKLDMLMKILLDFEYDTDLTKWTEAQFLSEYFYNCSKFVLEDPGVQELLRNASAKYSLIILEAS 143
            |...|:||..:       |||:                     ..|:.::|  :.:..||..:.:
plant    83 VTSTDLLMSAM-------DLTR---------------------DQVEAVVR--AVEPDLIFFDFA 117

  Fly   144 HNDALYGFSQHFNAPLLGVAAYGSSWNIDFLVGNSAPSVYEPMSALGYTSGLNLIEKWHNLIYIT 208
            |  .:...::.|....:......:|.....||......|..|    ||.|...|:          
plant   118 H--WIPEVARDFGLKTVKYVVVSASTIASMLVPGGELGVPPP----GYPSSKVLL---------- 166

  Fly   209 EERLVERFIYLPRQIDLY--KQHFPGATTSI-HDLRRRFSLVLINQHF----TMGRVRSNVPNIV 266
                        |:.|.|  |:..|..|..: .:|..|.:..|:|...    |...:..|..:.:
plant   167 ------------RKQDAYTMKKLEPTNTIDVGPNLLERVTTSLMNSDVIAIRTAREIEGNFCDYI 219

  Fly   267 EVAGMHLDEK--------PYP-----LDAELKKILDEAE-HGVIYFSMGLQLL---DHW--LPPG 312
            |   .|..:|        |.|     |:....|.|...| ..|::.::|.|::   |.:  |..|
plant   220 E---KHCRKKVLLTGPVFPEPDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLG 281

  Fly   313 MRASMSDAFAQLKQ-------QVIWKTDYPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGL 370
            |..:.|.....:|.       |......:.|.| :.|.:....|..|..||:||:|..|::|.|.
plant   282 MELTGSPFLVAVKPPRGSSTIQEALPEGFEERV-KGRGLVWGGWVQQPLILSHPSVGCFVSHCGF 345

  Fly   371 LSLIESVHYAVPLLCIPLFYDQFQNTKRMEKLGVARKLDFKNLFRDEIVLAIE 423
            .|:.||:.....::.:|...||..||:               |..||:.:::|
plant   346 GSMWESLLSDCQIVLVPQLGDQVLNTR---------------LLSDELKVSVE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 92/443 (21%)
UDPGT 39..507 CDD:278624 92/443 (21%)
AT4G27570NP_194487.1 PLN02764 1..452 CDD:178364 92/443 (21%)
MGT 15..414 CDD:273616 92/443 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.