DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT84A4

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_193285.1 Gene:UGT84A4 / 827222 AraportID:AT4G15500 Length:475 Species:Arabidopsis thaliana


Alignment Length:317 Identity:74/317 - (23%)
Similarity:116/317 - (36%) Gaps:101/317 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PSVYEPMSALGYTSG--LNLIEKWHNLIYITEERLVERFIYLPRQ-IDLYKQHFPGATTSIHDLR 241
            ||...|.|.|....|  |..|::.|....:    |:|.|..|.:. ||...|..|          
plant   184 PSFLHPSSPLSSIGGTILEQIKRLHKPFSV----LIETFQELEKDTIDHMSQLCP---------- 234

  Fly   242 RRFSLVLINQHFTMGR-VRSNVPNIVEVAGMHLDEKPYPLDAELKKILDEAE-HGVIYFSMGLQL 304
             :.:...|...|||.: :||::...:        .||   |::..:.||..| ..|:|.|.|   
plant   235 -QVNFNPIGPLFTMAKTIRSDIKGDI--------SKP---DSDCIEWLDSREPSSVVYISFG--- 284

  Fly   305 LDHWLPPGMRASMSDAFAQLKQQVI---------------WKTDYP-------------EMVNQS 341
                           ..|.|||..|               |....|             |:..:.
plant   285 ---------------TLAFLKQNQIDEIAHGILNSGLSCLWVLRPPLEGLAIEPHVLPLELEEKG 334

  Fly   342 RNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRMEKLGVAR 406
            :.|   .|..|..:|.||.|..|::|.|..|.:|::...||::|.|.:.||..|...|       
plant   335 KIV---EWCQQEKVLAHPAVACFLSHCGWNSTMEALTSGVPVICFPQWGDQVTNAVYM------- 389

  Fly   407 KLD-FKNLFR------DEIVLAIEDL---VYNASYKRNA---RDLSQRFHDQPMSAM 450
             :| ||...|      ||.::..|::   :..|:....|   |:.::|:.::..||:
plant   390 -IDVFKTGLRLSRGASDERIVPREEVAERLLEATVGEKAVELRENARRWKEEAESAV 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 74/317 (23%)
UDPGT 39..507 CDD:278624 74/317 (23%)
UGT84A4NP_193285.1 PLN02555 1..475 CDD:178170 74/317 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.