DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT71B5

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001328018.1 Gene:UGT71B5 / 827194 AraportID:AT4G15280 Length:510 Species:Arabidopsis thaliana


Alignment Length:255 Identity:60/255 - (23%)
Similarity:110/255 - (43%) Gaps:62/255 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 RRFSLVLINQHFTMGRVRSNVPNIVEVAGMHLDEKP--YPL---------------DAELKKILD 289
            |:...:|:|   |:..:.   |:.:::..::.|:.|  ||:               .:|:.:.||
plant   240 RKMKGILVN---TVAELE---PHALKMFNINGDDLPQVYPVGPVLHLENGNDDDEKQSEILRWLD 298

  Fly   290 E-AEHGVIYFSMGLQLLDHWLPPGMRASMSDAFAQLKQQVIW---------KTDYPEMVNQSRNV 344
            | ....|::...|  .|..:.....|.: :.|..:..|:.:|         |||.|........|
plant   299 EQPSKSVVFLCFG--SLGGFTEEQTRET-AVALDRSGQRFLWCLRHASPNIKTDRPRDYTNLEEV 360

  Fly   345 -----FART--------WFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNT 396
                 ..||        |.||.|:|..|.:..|:||.|..|::||:.:.||::..||:.:|..|.
plant   361 LPEGFLERTLDRGKVIGWAPQVAVLEKPAIGGFVTHCGWNSILESLWFGVPMVTWPLYAEQKVNA 425

  Fly   397 KRM-EKLGVA---RKLDFKNLFRDEI-VLAIED--------LVYNASYKRNARDLSQRFH 443
            ..| |:||:|   ||....:||..|: .:..||        :..::..:.|.::::::.|
plant   426 FEMVEELGLAVEIRKYLKGDLFAGEMETVTAEDIERAIRRVMEQDSDVRNNVKEMAEKCH 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 60/255 (24%)
UDPGT 39..507 CDD:278624 60/255 (24%)
UGT71B5NP_001328018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.