DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT3G55700

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_191129.1 Gene:AT3G55700 / 824736 AraportID:AT3G55700 Length:460 Species:Arabidopsis thaliana


Alignment Length:159 Identity:37/159 - (23%)
Similarity:60/159 - (37%) Gaps:52/159 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 VEVA-GMHLDEKPYPLDAELKKILDEAEHGVIYFSMGLQLLDHWLPPGMRASMSDAFAQLKQQVI 329
            :|:| |:...|:|:         |.....|.:   .|.:.|:. ||.|...::.|     |.:::
plant   285 LEIAWGLRNSERPF---------LWVVRPGSV---RGTEWLES-LPLGFMENIGD-----KGKIV 331

  Fly   330 WKTDYPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQ 394
                              .|..|..:|.||.:..|.||.|..|.:||:...||::|...|.||..
plant   332 ------------------KWANQLEVLAHPAIGAFWTHCGWNSTLESICEGVPMICTSCFTDQHV 378

  Fly   395 NTK---------------RMEKLGVARKL 408
            |.:               :|||..:.:.|
plant   379 NARYIVDVWRVGMLLERSKMEKKEIEKVL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 37/159 (23%)
UDPGT 39..507 CDD:278624 37/159 (23%)
AT3G55700NP_191129.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 37/159 (23%)
YjiC 8..427 CDD:224732 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.