DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT73D1

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_190883.2 Gene:UGT73D1 / 824481 AraportID:AT3G53150 Length:516 Species:Arabidopsis thaliana


Alignment Length:415 Identity:84/415 - (20%)
Similarity:139/415 - (33%) Gaps:162/415 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 YSLIILEASHNDALYGFSQHFNAPLLGVAAYGSSWNIDFLVGNSAPSVYEPMSALGYTSGLNLIE 199
            :||:   :|||       .|.::|.|.|:                 |..||....|         
plant   165 FSLL---SSHN-------IHLHSPHLSVS-----------------SAVEPFPIPG--------- 193

  Fly   200 KWHNLIYITEERLVERFIYLPRQIDLYKQHFPGA---TTSIHDLRRRFSL-------VLINQHFT 254
                               :|.:|::.:...|||   ..::.|:|.:...       |::|.   
plant   194 -------------------MPHRIEIARAQLPGAFEKLANMDDVREKMRESESEAFGVIVNS--- 236

  Fly   255 MGRVRSNVPNIVEVAGMHLDEK-----PYPL-DAELKKILDEAEHGVIYFSMG--LQLLDHWLP- 310
               .:...|...|.....:::|     |..| :..:..:.|...:|.|..|..  ||.||...| 
plant   237 ---FQELEPGYAEAYAEAINKKVWFVGPVSLCNDRMADLFDRGSNGNIAISETECLQFLDSMRPR 298

  Fly   311 --------------PGMRASMSDAFAQLKQQVIW--KTDYPEMVN--------------QSRNVF 345
                          |.....:.....:..:..||  ||:...|:.              :.|.:.
plant   299 SVLYVSLGSLCRLIPNQLIELGLGLEESGKPFIWVIKTEEKHMIELDEWLKRENFEERVRGRGIV 363

  Fly   346 ARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRM----------- 399
            .:.|.||..||:|.:...|:||.|..|.||::.:.||::..|||.:||.|.|.:           
plant   364 IKGWSPQAMILSHGSTGGFLTHCGWNSTIEAICFGVPMITWPLFAEQFLNEKLIVEVLNIGVRVG 428

  Fly   400 ----------EKLGVARKLDFKNLFRDEIVLAIEDLVYNASYKRNARDLSQRFHDQPMSAMDTAI 454
                      |:|||..|       :..:|.||:.|:                 ||....:|...
plant   429 VEIPVRWGDEERLGVLVK-------KPSVVKAIKLLM-----------------DQDCQRVDEND 469

  Fly   455 WWTEYILRHKGADHMRIAEQEMSLM 479
            ...|::.|.:     ||  ||:::|
plant   470 DDNEFVRRRR-----RI--QELAVM 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 79/399 (20%)
UDPGT 39..507 CDD:278624 84/415 (20%)
UGT73D1NP_190883.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.