DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT72E1

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_566938.1 Gene:UGT72E1 / 824238 AraportID:AT3G50740 Length:487 Species:Arabidopsis thaliana


Alignment Length:542 Identity:111/542 - (20%)
Similarity:188/542 - (34%) Gaps:199/542 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PHI-----EGVHHIRVPKLDMLMKILLDFEYDTDLTKWTEAQFLSEYFYNCSKFVLEDPGVQELL 128
            ||:     .|:.|| :|.:::..::.....:|..:                  ||||        
plant     6 PHVAMFASPGMGHI-IPVIELGKRLAGSHGFDVTI------------------FVLE-------- 43

  Fly   129 RNASAKYSLIILEASHNDALYGFSQHFNAP--------LLGVAAYGSSWNID----------FLV 175
                            .||....||..|:|        ::|:.....|..:|          .::
plant    44 ----------------TDAASAQSQFLNSPGCDAALVDIVGLPTPDISGLVDPSAFFGIKLLVMM 92

  Fly   176 GNSAPSV--------YEPMSALGYTSGLNLIE---KWHNLIYI---------------------- 207
            ..:.|::        ::|.:.:....||:.|.   :::.|.||                      
plant    93 RETIPTIRSKIEEMQHKPTALIVDLFGLDAIPLGGEFNMLTYIFIASNARFLAVALFFPTLDKDM 157

  Fly   208 TEERLVE------------RF-----IYLPRQIDLYKQHFP---------GATTSIHDLRRRFSL 246
            .||.:::            ||     .:|.....||::..|         |...:..|.....:|
plant   158 EEEHIIKKQPMVMPGCEPVRFEDTLETFLDPNSQLYREFVPFGSVFPTCDGIIVNTWDDMEPKTL 222

  Fly   247 VLINQHFTMGRVRSNVPNIVEVAGMHLDEKP----YPLDAELKKILDEAEHGVIYFSMG------ 301
            ..:.....:||: :.|| :..:..:.....|    :|:...|.|..||:   |:|.|.|      
plant   223 KSLQDPKLLGRI-AGVP-VYPIGPLSRPVDPSKTNHPVLDWLNKQPDES---VLYISFGSGGSLS 282

  Fly   302 -LQLLDHWLPPGMRASMSDAFAQLKQQVIW-------------------------KTDY-PE-MV 338
             .||.:  |..|:..|        :|:.:|                         ..|| || .|
plant   283 AKQLTE--LAWGLEMS--------QQRFVWVVRPPVDGSACSAYLSANSGKIRDGTPDYLPEGFV 337

  Fly   339 NQS--RNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQN-TKRME 400
            :::  |.....:|.||..||.|..|..|:||.|..|::|||...||::..|||.:|..| |...|
plant   338 SRTHERGFMVSSWAPQAEILAHQAVGGFLTHCGWNSILESVVGGVPMIAWPLFAEQMMNATLLNE 402

  Fly   401 KLGVA---RKLDFKNLF-RDEIVLAIEDLVYNASYKRNARDLSQRFHDQPMSAMDTAIWWTEYIL 461
            :||||   :||..:.:. |.|    ||.||.....:....::.::.    ....:||   .|.:.
plant   403 ELGVAVRSKKLPSEGVITRAE----IEALVRKIMVEEEGAEMRKKI----KKLKETA---AESLS 456

  Fly   462 RHKGADH---MRIAEQEMSLMQ 480
            ...|..|   .|||::...|::
plant   457 CDGGVAHESLSRIADESEHLLE 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 105/522 (20%)
UDPGT 39..507 CDD:278624 111/542 (20%)
UGT72E1NP_566938.1 PLN02992 1..487 CDD:178572 111/542 (20%)
YjiC 5..479 CDD:224732 111/542 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.