DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT3G46700

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_190254.2 Gene:AT3G46700 / 823823 AraportID:AT3G46700 Length:447 Species:Arabidopsis thaliana


Alignment Length:435 Identity:86/435 - (19%)
Similarity:155/435 - (35%) Gaps:147/435 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TPFLRNLVQRGHQLTLISAVTIMPHIE-----------GVHHIRVPKLDMLMKILLDFEYD---- 95
            ||    ::|.|..|.|.....|:|..|           |...|.:|          |.|.:    
plant    22 TP----MMQLGQALILKGFSIIVPQGEFNRVNSSQKFPGFQFITIP----------DSELEANGP 72

  Fly    96 ----TDLTKWTEAQFLSEYFYNCSKFVLEDPGVQELLRNASAKYSLIILEASHNDALY---GFSQ 153
                |.|.|..||.     |.:|         :::||:......:.||    :::.:|   ..::
plant    73 VGSLTQLNKIMEAS-----FKDC---------IRQLLKQQGNDIACII----YDEFMYFCGAVAE 119

  Fly   154 HFNAPLLGVAAYGSSWNIDFLVGNSAP------SVYEPMSALGYTSGL-------NLIEKWHNLI 205
            ....|             :|:......      :|...::|..|...:       .::|..|.|.
plant   120 ELKLP-------------NFIFSTQTATHKVCCNVLSKLNAKKYLIDMEEHDVQNKVVENMHPLR 171

  Fly   206 Y-----ITEERLVERFIYLPRQIDLYKQHFPGATTSIHDLRRRFSLVLIN-----QHFTMGRVRS 260
            |     .|...| |.|:.|.|.:             ::  :|..|.|:||     :..::.|::.
plant   172 YKDLPTATFGEL-EPFLELCRDV-------------VN--KRTASAVIINTVTCLESSSLTRLQQ 220

  Fly   261 --NVPNIVEVAGMHLDEKP--YPLDAELKKILD----EAEHGVIYFSMGLQLLDH---------- 307
              .:| :..:..:|:.:..  :.:..|.:..::    :....|||.|:|..:|..          
plant   221 ELQIP-VYPLGPLHITDSSTGFTVLQEDRSCVEWLNKQKPRSVIYISLGSMVLMETKEMLEMAWG 284

  Fly   308 ---------W-LPPGMRASMSDAFAQLKQQVIWKTDYPEMVNQSRNVFARTWFPQRAILNHPNVK 362
                     | :.|| ..|.|:....|.::|      .:||.:...:.  .|.||..:|.||:|.
plant   285 MLNSNQPFLWVIRPG-SVSGSEGIESLPEEV------SKMVLEKGYIV--KWAPQIEVLGHPSVG 340

  Fly   363 LFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRME---KLGV 404
            .|.:|.|..|.:||:...||::|.|...:|..|...:|   ::|:
plant   341 GFWSHCGWNSTLESIVEGVPMICRPYQGEQMLNAIYLESVWRIGI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 86/435 (20%)
UDPGT 39..507 CDD:278624 86/435 (20%)
AT3G46700NP_190254.2 Glycosyltransferase_GTB_type 1..446 CDD:299143 86/435 (20%)
YjiC 7..426 CDD:224732 86/435 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.