DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT76E11

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_190251.1 Gene:UGT76E11 / 823820 AraportID:AT3G46670 Length:451 Species:Arabidopsis thaliana


Alignment Length:262 Identity:59/262 - (22%)
Similarity:110/262 - (41%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 LIEKWHNLIYITEERLVERFIYLPRQIDLYKQHFPGATTSIHDLRRRFSLVLIN-----QHFTMG 256
            |:.::|.|  ..::..|..:..|...::||:....         :|..|.|:||     :..::.
plant   168 LVPEFHPL--RCKDFPVSHWASLESMMELYRNTVD---------KRTASSVIINTASCLESSSLS 221

  Fly   257 RVRS--NVPNIVEVAGMHL-DEKPYPLDAELKKILD----EAEHGVIYFSMG---LQLLDHWLPP 311
            |::.  .:| :..:..:|| ......|..|.|..::    :.::.||:.|:|   |..::..:..
plant   222 RLQQQLQIP-VYPIGPLHLVASASTSLLEENKSCIEWLNKQKKNSVIFVSLGSLALMEINEVIET 285

  Fly   312 GMRASMSDAFAQLKQQVIW-----KTDYPEMVNQSRNVFAR---------TWFPQRAILNHPNVK 362
            .:....|      |||.:|     .....|.:......|::         .|.||:.:|:||.|.
plant   286 ALGLDSS------KQQFLWVIRPGSVRGSEWIENLPKEFSKIISGRGYIVKWAPQKEVLSHPAVG 344

  Fly   363 LFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRME---KLGVARKLDFKNLFRDEIVLAIED 424
            .|.:|.|..|.:||:...||::|.|...||..|.:.:|   |:|:..:.|   |.|..:..|:..
plant   345 GFWSHCGWNSTLESIGEGVPMICKPFSSDQMVNARYLECVWKIGIQVEGD---LDRGAVERAVRR 406

  Fly   425 LV 426
            |:
plant   407 LM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 59/262 (23%)
UDPGT 39..507 CDD:278624 59/262 (23%)
UGT76E11NP_190251.1 PLN02410 1..451 CDD:178032 59/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.