DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT76E12

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_566885.1 Gene:UGT76E12 / 823819 AraportID:AT3G46660 Length:458 Species:Arabidopsis thaliana


Alignment Length:388 Identity:93/388 - (23%)
Similarity:158/388 - (40%) Gaps:92/388 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 DFEY--------DTDLTKWTEAQFLSEYFYNCSKFVLEDPGVQELLRNASAKYSLIILEASHNDA 147
            ||::        ::|.......|||.:....| |...:| .:.:|:...|.:.|.:|    :::.
plant    62 DFQFVTIPESLPESDFKNLGPIQFLFKLNKEC-KVSFKD-CLGQLVLQQSNEISCVI----YDEF 120

  Fly   148 LYGFSQHFNAPLLGVAAYGSSWNIDFLVGNSAP----SVYEPMSA------LGYTSGL--NLIEK 200
            :| |::       ..|......||.|...::..    ||::.:.|      |..|.|.  .|:.:
plant   121 MY-FAE-------AAAKECKLPNIIFSTTSATAFACRSVFDKLYANNVQAPLKETKGQQEELVPE 177

  Fly   201 WHNLIYITEERLVERFIYLPRQIDLYKQHFPGATTSIHDLRRRFSLVLINQHFTMGRVRSN---- 261
            ::.|.|  ::..|.||..|...:::|:....         :|..|.|:||   |...:.|:    
plant   178 FYPLRY--KDFPVSRFASLESIMEVYRNTVD---------KRTASSVIIN---TASCLESSSLSF 228

  Fly   262 -------VPNIVEVAGMHL-DEKPYPLDAELKKILD----EAEHGVIYFSMG-LQLLD----HWL 309
                   :| :..:..:|: ...|..|..|.|..::    :..:.|||.||| :.|::    ..:
plant   229 LQQQQLQIP-VYPIGPLHMVASAPTSLLEENKSCIEWLNKQKVNSVIYISMGSIALMEINEIMEV 292

  Fly   310 PPGMRASMSDAFAQLKQQVI----WKTDYPEMVNQSRNVFAR----TWFPQRAILNHPNVKLFIT 366
            ..|:.||.......::...|    |....||  ..|:.|..|    .|.||:.:|:||.|..|.:
plant   293 ASGLAASNQHFLWVIRPGSIPGSEWIESMPE--EFSKMVLDRGYIVKWAPQKEVLSHPAVGGFWS 355

  Fly   367 HAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRME---KLG--VARKLD-------FKNLFRDE 417
            |.|..|.:||:...||::|.|...||..|.:.:|   |:|  |..:||       .|.|..||
plant   356 HCGWNSTLESIGQGVPMICRPFSGDQKVNARYLECVWKIGIQVEGELDRGVVERAVKRLMVDE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 93/388 (24%)
UDPGT 39..507 CDD:278624 93/388 (24%)
UGT76E12NP_566885.1 PLN02410 6..458 CDD:178032 93/388 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.