DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT3G29630

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_189604.1 Gene:AT3G29630 / 822631 AraportID:AT3G29630 Length:448 Species:Arabidopsis thaliana


Alignment Length:460 Identity:93/460 - (20%)
Similarity:158/460 - (34%) Gaps:166/460 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FGSSYLLITPFL---RNLVQRGHQLTLISAVTIMPHIE-------GVH--HIRVPKLDMLMKILL 90
            ||..:::  |:|   ..|.::||::|.::.......:|       .:|  ::.:|.:|.|.   :
plant    13 FGFGHMI--PYLHLANKLAEKGHRVTFLAPKKAQKQLEPLNLFPNSIHFENVTLPHVDGLP---V 72

  Fly    91 DFEYDTDLTKWTEAQFLSEYFYNCSKFVLEDPGVQELLRN------ASAKYSLIILEASHNDALY 149
            ..|...||.             |.||.||.|  ..:|||.      .|.|..||..:.       
plant    73 GAETTADLP-------------NSSKRVLAD--AMDLLREQIEVKIRSLKPDLIFFDF------- 115

  Fly   150 GFSQHFNAPLLGVAAYGSSWNIDFLVGNSAPSVYEPMSA--LGYTSGLNLIEKWHNLIYITEERL 212
                                 :|::          |..|  ||..|             ::.:.:
plant   116 ---------------------VDWI----------PQMAKELGIKS-------------VSYQII 136

  Fly   213 VERFI---YLPR-QIDLYKQHFPGATTSI--HDLRRRFSLVLINQHFTMGRVRSNVPN------- 264
            ...||   :.|| ::......||.:..::  || ...:||....:.|...||.:.:.|       
plant   137 SAAFIAMFFAPRAELGSPPPGFPSSKVALRGHD-ANIYSLFANTRKFLFDRVTTGLKNCDVIAIR 200

  Fly   265 -IVEVAG-------------------MHLD---EKPYPLDAELKKILDEAE-HGVIYFSM----- 300
             ..|:.|                   |.||   :...||:......|:..| ..|:|.:.     
plant   201 TCAEIEGNLCDFIERQCQRKVLLTGPMFLDPQGKSGKPLEDRWNNWLNGFEPSSVVYCAFGTHFF 265

  Fly   301 ----------------GLQLLDHWLPPGMRASMSDAFAQLKQQVIWKTDYPEMVNQSRNVFARTW 349
                            ||..|...:||...:::.:|..:         .:.|.: :.|.:....|
plant   266 FEIDQFQELCLGMELTGLPFLVAVMPPRGSSTIQEALPE---------GFEERI-KGRGIVWGGW 320

  Fly   350 FPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRM-EKLGVARKLDFKNL 413
            ..|..||:||::..|:.|.|..|:.||:.....::.||...||...|:.: |:|.|:.|:.    
plant   321 VEQPLILSHPSIGCFVNHCGFGSMWESLVSDCQIVFIPQLVDQVLTTRLLTEELEVSVKVK---- 381

  Fly   414 FRDEI 418
             ||||
plant   382 -RDEI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 93/460 (20%)
UDPGT 39..507 CDD:278624 92/459 (20%)
AT3G29630NP_189604.1 PLN00414 1..448 CDD:177807 93/460 (20%)
MGT 14..427 CDD:273616 92/459 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.