DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT71B8

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_188817.1 Gene:UGT71B8 / 821734 AraportID:AT3G21800 Length:480 Species:Arabidopsis thaliana


Alignment Length:363 Identity:77/363 - (21%)
Similarity:127/363 - (34%) Gaps:127/363 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LGVAAYGSSWNIDFLVGNSAPSVYE-------------------PMSALGYTSGLNLIEKWHNLI 205
            :|:.|.|  .:|..|......||.|                   |:..|.|  || ..::|..: 
plant   141 VGILALG--LHIQMLFDKKEYSVSETDFEDSEVVLDVPSLTCPYPVKCLPY--GL-ATKEWLPM- 199

  Fly   206 YITEER--------LVERFIYLPRQIDLYKQHFPGATTSIHDLRRRFSLVLINQHFTMGRVRSNV 262
            |:.:.|        ||..|..|.          |.|..|:|.                   ..:.
plant   200 YLNQGRRFREMKGILVNTFAELE----------PYALESLHS-------------------SGDT 235

  Fly   263 PNIVEVAGM-----HLDEKPYPLDAELKKILDE-AEHGVIYFSMG----------------LQLL 305
            |....|..:     |:|.......:::.:.||| ....|::...|                |:..
plant   236 PRAYPVGPLLHLENHVDGSKDEKGSDILRWLDEQPPKSVVFLCFGSIGGFNEEQAREMAIALERS 300

  Fly   306 DHWLPPGMRASMSDAFAQLK------QQVIWKTDYPEMVNQSRNVFART--------WFPQRAIL 356
            .|.....:|.:..|...:|.      ::::     ||      ..|.||        |.||.|:|
plant   301 GHRFLWSLRRASRDIDKELPGEFKNLEEIL-----PE------GFFDRTKDKGKVIGWAPQVAVL 354

  Fly   357 NHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQ-FQNTKRMEKLGVARKLDFKNLFR----- 415
            ..|.:..|:||.|..|::||:.:.||:...||:.:| |.....:|:||:|.|:  :..:|     
plant   355 AKPAIGGFVTHCGWNSILESLWFGVPIAPWPLYAEQKFNAFVMVEELGLAVKI--RKYWRGDQLV 417

  Fly   416 ---------DEIVLAIEDLVYNASYKRN-ARDLSQRFH 443
                     :||...|..|:...|..|| .:::|::.|
plant   418 GTATVIVTAEEIERGIRCLMEQDSDVRNRVKEMSKKCH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 77/363 (21%)
UDPGT 39..507 CDD:278624 77/363 (21%)
UGT71B8NP_188817.1 PLN02554 2..480 CDD:215304 77/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.