DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and HYR1

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_188813.1 Gene:HYR1 / 821730 AraportID:AT3G21760 Length:485 Species:Arabidopsis thaliana


Alignment Length:419 Identity:90/419 - (21%)
Similarity:160/419 - (38%) Gaps:118/419 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DTDLTKWTEAQFLSEYFYNCSKFV------LEDPGVQE----LLRNASAKYSLIILEASHNDALY 149
            |:|.||    ....:|..|....|      |.|||..:    |.......:.:::::.::.   :
plant    78 DSDDTK----PHFFDYIDNFKPQVKATVEKLTDPGPPDSPSRLAGFVVDMFCMMMIDVANE---F 135

  Fly   150 GFSQHF----NAPLLGVAAYGSSWNIDFL--VGN--------------SAPSVYEPMSALGYTSG 194
            |...:.    ||..||:..:     :::|  |.|              ..|.:..|:....:.|.
plant   136 GVPSYMFYTSNATFLGLQVH-----VEYLYDVKNYDVSDLKDSDTTELEVPCLTRPLPVKCFPSV 195

  Fly   195 LNLIEKWHNLIYITEER-------LVERFIYLPRQIDLYKQHFPGATTSIHDLRRRFSLVLINQH 252
            | |.::|..:::....|       ||..|..|..|.   .:.|.|..:.:..:            
plant   196 L-LTKEWLPVMFRQTRRFRETKGILVNTFAELEPQA---MKFFSGVDSPLPTV------------ 244

  Fly   253 FTMGRV---RSNVPNIVEVAGMHLDEKPYPLDAELKKILDEAEHGVIYF----SMGLQLLDHWLP 310
            :|:|.|   :.|.||       ..|:|    .:|:.:.|||.....:.|    |||      ...
plant   245 YTVGPVMNLKINGPN-------SSDDK----QSEILRWLDEQPRKSVVFLCFGSMG------GFR 292

  Fly   311 PGMRASMSDAFAQLKQQVIWK----------------TDYPEMVNQSRNVFART--------WFP 351
            .|....::.|..:...:.:|.                |:..|::.:  ....||        |.|
plant   293 EGQAKEIAIALERSGHRFVWSLRRAQPKGSIGPPEEFTNLEEILPE--GFLERTAEIGKIVGWAP 355

  Fly   352 QRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRM-EKLGVARKLDFKNLFR 415
            |.|||.:|.:..|::|.|..|.:||:.:.||:...||:.:|..|...| |:||:|  ::.:|.||
plant   356 QSAILANPAIGGFVSHCGWNSTLESLWFGVPMATWPLYAEQQVNAFEMVEELGLA--VEVRNSFR 418

  Fly   416 DEIVLAIEDLVYNASYKRNARDLSQRFHD 444
            .:.:.|.::|:.....:|..|.|.::..|
plant   419 GDFMAADDELMTAEEIERGIRCLMEQDSD 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 90/419 (21%)
UDPGT 39..507 CDD:278624 90/419 (21%)
HYR1NP_188813.1 PLN02554 1..485 CDD:215304 90/419 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.