DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT88A1

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_566550.1 Gene:UGT88A1 / 820900 AraportID:AT3G16520 Length:462 Species:Arabidopsis thaliana


Alignment Length:491 Identity:89/491 - (18%)
Similarity:167/491 - (34%) Gaps:154/491 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ITPFLRNLVQRGHQLTLISAVTIMPHIEGVH----------HIRVPKLDMLMKILLDFEYDTDLT 99
            :||:..:...|.|..:|:..:....: ..||          ::|...:|.....:||.  ..|.|
plant    72 VTPYSSSSTSRHHHESLLLEILCFSN-PSVHRTLFSLSRNFNVRAMIIDFFCTAVLDI--TADFT 133

  Fly   100 KWTEAQFLSEYFYN----CSKFVLEDPGVQELLRNASAKYSLIILEASHNDALYGFSQHFNAPLL 160
                  |...:||.    |..|....|.:.|.....:.|                     :.|.:
plant   134 ------FPVYFFYTSGAACLAFSFYLPTIDETTPGKNLK---------------------DIPTV 171

  Fly   161 GVAAYGSSWNIDFLVGNSAP--------SVYEPMSALGYTSGLNLIEKWHNLIYITEERLVERFI 217
            .:.      .:..:.|:..|        .||:.....|     ..:.|...:|..|.:.|..|.|
plant   172 HIP------GVPPMKGSDMPKAVLERDDEVYDVFIMFG-----KQLSKSSGIIINTFDALENRAI 225

  Fly   218 YLPRQIDLYKQHFPGATTSIHDLRRRFSLVLINQHFTMGRVRSNVPNIVEVAGMHLDEKPYPLDA 282
            ....:...::..:|            ...:::|     ||:.....|........||.:|     
plant   226 KAITEELCFRNIYP------------IGPLIVN-----GRIEDRNDNKAVSCLNWLDSQP----- 268

  Fly   283 ELKKILDEAEHGVIYF---SMGL----QLLD------------HWL---PPGMRASMSDAFAQLK 325
                     |..|::.   |:||    |:::            .|:   ||.:..:..|..:.|.
plant   269 ---------EKSVVFLCFGSLGLFSKEQVIEIAVGLEKSGQRFLWVVRNPPELEKTELDLKSLLP 324

  Fly   326 QQVIWKTDYPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFY 390
            :..:.:|:...||       .::|.||..:|||..|..|:||.|..|::|:|...||::..||:.
plant   325 EGFLSRTEDKGMV-------VKSWAPQVPVLNHKAVGGFVTHCGWNSILEAVCAGVPMVAWPLYA 382

  Fly   391 DQFQNTKRMEKLGVARKLDFKNLFRDEIVLAIE------DLVYNASYKRNARDLSQR--FHDQPM 447
            :|     |..::.:.          |||.:||.      ..|.:...::..:::...  ..::.|
plant   383 EQ-----RFNRVMIV----------DEIKIAISMNESETGFVSSTEVEKRVQEIIGECPVRERTM 432

  Fly   448 SAMDTAIWWTEYILRHKGADHMRIAEQEMSLMQYYN 483
            :..:.|    |..|...|:.|..:.    :|:|.::
plant   433 AMKNAA----ELALTETGSSHTALT----TLLQSWS 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 85/471 (18%)
UDPGT 39..507 CDD:278624 89/491 (18%)
UGT88A1NP_566550.1 PLN03004 1..451 CDD:178581 87/476 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.