DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT76B1

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_187742.1 Gene:UGT76B1 / 820307 AraportID:AT3G11340 Length:447 Species:Arabidopsis thaliana


Alignment Length:175 Identity:45/175 - (25%)
Similarity:75/175 - (42%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 EAEHGVIYFSMG-LQLLDH-------WLPPGMRASMSDAFAQLKQQVIWKTDYPEMVNQS--RNV 344
            :|.:.|||.|:| :..:|.       |   |:|.|.......::..:|...::.|::.:.  .|:
plant   257 QATNSVIYASLGSIASIDESEFLEIAW---GLRNSNQPFLWVVRPGLIHGKEWIEILPKGFIENL 318

  Fly   345 FAR----TWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRME---KL 402
            ..|    .|.||..:|.|.....|:||.|..|.:|.:..|:|::|.|.|.||..|.:.:.   |:
plant   319 EGRGKIVKWAPQPEVLAHRATGGFLTHCGWNSTLEGICEAIPMICRPSFGDQRVNARYINDVWKI 383

  Fly   403 GVARKLDFKNLFRDEIVLAIEDLVYNASYKRNARDLSQRFHDQPM 447
            |    |..:|....   |.||:.|..........::.:|.  .||
plant   384 G----LHLENKVER---LVIENAVRTLMTSSEGEEIRKRI--MPM 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 45/175 (26%)
UDPGT 39..507 CDD:278624 45/175 (26%)
UGT76B1NP_187742.1 Glycosyltransferase_GTB-type 1..444 CDD:415824 45/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.