DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT74F2

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_181910.1 Gene:UGT74F2 / 818986 AraportID:AT2G43820 Length:449 Species:Arabidopsis thaliana


Alignment Length:115 Identity:33/115 - (28%)
Similarity:65/115 - (56%) Gaps:12/115 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 EMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRME 400
            |.||:.:::..: |.||..:|::..:..|:||.|..|.:|::.:.||::.:|.:.||..|.|.::
plant   312 ETVNKEKSLVLK-WSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGVPMVAMPQWTDQPMNAKYIQ 375

  Fly   401 ---KLGVARKLDFKN--LFRDEIVLAIEDLV---YNASYKRNA---RDLS 439
               |.||..|.:.::  ..|:||..:|::::   .:...|:|.   |||:
plant   376 DVWKAGVRVKTEKESGIAKREEIEFSIKEVMEGERSKEMKKNVKKWRDLA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 33/115 (29%)
UDPGT 39..507 CDD:278624 33/115 (29%)
UGT74F2NP_181910.1 PLN02173 1..449 CDD:177830 33/115 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.