DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT73C6

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_181217.1 Gene:UGT73C6 / 818251 AraportID:AT2G36790 Length:495 Species:Arabidopsis thaliana


Alignment Length:521 Identity:108/521 - (20%)
Similarity:207/521 - (39%) Gaps:126/521 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YLLITPFL------------RNLVQRGHQLTLISAVTIMPH------------IEG---VHHIRV 79
            :.::.||:            |.|.|||..:|:::.    ||            ||.   ::.::|
plant    13 HFVLFPFMAQGHMIPMVDIARLLAQRGVLITIVTT----PHNAARFKNVLNRAIESGLPINLVQV 73

  Fly    80 PKLDMLMKILLDFEYDTDLTKWTEAQFLSEYFYNCSKFVLEDPGVQELLRNASAKYSLIILE--A 142
             |.......|.:.:.:.||.  |..:.::.:|...:  :|::| ||.|:...|.:.|.:|.:  .
plant    74 -KFPYQEAGLQEGQENMDLL--TTMEQITSFFKAVN--LLKEP-VQNLIEEMSPRPSCLISDMCL 132

  Fly   143 SHNDALYGFSQHFNAPLL---GVAAYGSSWNIDFLVGNSAPSVYEPMSALGYTSGLNLIEKWHNL 204
            |:...:   ::.|..|.:   |:..:      ..|..|......|.:..|.......::..:.:.
plant   133 SYTSEI---AKKFKIPKILFHGMGCF------CLLCVNVLRKNREILDNLKSDKEYFIVPYFPDR 188

  Fly   205 IYITEERL-VERFI------YLPRQIDLYKQHFPGATTSIHDLR----RRFSLVLINQHFTMGRV 258
            :..|..:: ||.::      .|...::..|..:.....|..:|.    :.|......:.:|:|.|
plant   189 VEFTRPQVPVETYVPAGWKEILEDMVEADKTSYGVIVNSFQELEPAYAKDFKEARSGKAWTIGPV 253

  Fly   259 RSNVPNIVEVAGMHLDEKPYPLDA---ELKKILDEAEHG-VIYFSMG-------LQLLDHWLPPG 312
                 ::....|:...|:....|.   |..:.||..|.| |:|..:|       .|||:  |..|
plant   254 -----SLCNKVGVDKAERGNKSDIDQDECLEWLDSKEPGSVLYVCLGSICNLPLSQLLE--LGLG 311

  Fly   313 MRASMSD------AFAQLKQQVIW--KTDYPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAG 369
            :..|...      .:.:.|:.|.|  ::.:.:.: |.|.:..:.|.||..||:||:|..|:||.|
plant   312 LEESQRPFIWVIRGWEKYKELVEWFSESGFEDRI-QDRGLLIKGWSPQMLILSHPSVGGFLTHCG 375

  Fly   370 LLSLIESVHYAVPLLCIPLFYDQFQNTK---RMEKLGVARKLDFKNLF-------------RDEI 418
            ..|.:|.:...:|:|..|||.|||.|.|   ::.|:||:.::  |.:.             ::.:
plant   376 WNSTLEGITAGLPMLTWPLFADQFCNEKLVVQILKVGVSAEV--KEVMKWGEEEKIGVLVDKEGV 438

  Fly   419 VLAIEDLVYNA----SYKRNARDLSQRFHDQPMSAMDTAIWWTEYILRHKGADHMRIAEQEMSLM 479
            ..|:|:|:..:    ..:|.|::|.:..|.               .:...|:.|..|......:|
plant   439 KKAVEELMGESDDAKERRRRAKELGESAHK---------------AVEEGGSSHSNITFLLQDIM 488

  Fly   480 Q 480
            |
plant   489 Q 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 103/504 (20%)
UDPGT 39..507 CDD:278624 108/521 (21%)
UGT73C6NP_181217.1 Glycosyltransferase_GTB-type 12..494 CDD:385653 108/521 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.