DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT87A2

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_180575.1 Gene:UGT87A2 / 817566 AraportID:AT2G30140 Length:455 Species:Arabidopsis thaliana


Alignment Length:307 Identity:72/307 - (23%)
Similarity:117/307 - (38%) Gaps:95/307 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 LIEKWHNLIYITEERLVE--------RFIYLPRQIDLYK-----------QHFPGAT----TSIH 238
            ||...|.|...:||.:|:        :...||...|.|.           ...|||.    |:.:
plant   154 LISHGHALFEPSEEEVVDYVPGLSPTKLRDLPPIFDGYSDRVFKTAKLCFDELPGARSLLFTTAY 218

  Fly   239 DLRRR----FSLVLINQHFTMGRV----------RSNVPNIVEVAGMHLDEKPYPLDAELKKILD 289
            :|..:    |:..|....:.:|.:          .:..||.::    .|:|:|            
plant   219 ELEHKAIDAFTSKLDIPVYAIGPLIPFEELSVQNDNKEPNYIQ----WLEEQP------------ 267

  Fly   290 EAEHGVIYFSMGLQLLDHWLPPGMRASMSDAFAQLKQQV----------IW-----KTDYPEMVN 339
              |..|:|.|.|..|           |:|:  ||:::.|          :|     :....|.:.
plant   268 --EGSVLYISQGSFL-----------SVSE--AQMEEIVKGLRESGVRFLWVARGGELKLKEALE 317

  Fly   340 QSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRME---K 401
            .|..|.. :|..|..:|.|..|..|.||.|..|.:|.::..||:|..|||:||..|.|.:.   :
plant   318 GSLGVVV-SWCDQLRVLCHKAVGGFWTHCGFNSTLEGIYSGVPMLAFPLFWDQILNAKMIVEDWR 381

  Fly   402 LGVARKLDFKN---LFRDEIVLAIEDLVYNAS-----YKRNARDLSQ 440
            :|:..:...||   :.|:||...::..:...|     .:|.|.|||:
plant   382 VGMRIERTKKNELLIGREEIKEVVKRFMDRESEEGKEMRRRACDLSE 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 72/307 (23%)
UDPGT 39..507 CDD:278624 72/307 (23%)
UGT87A2NP_180575.1 PLN02448 2..455 CDD:215247 72/307 (23%)
YjiC 13..450 CDD:224732 72/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.