DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT84B1

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_179907.1 Gene:UGT84B1 / 816858 AraportID:AT2G23260 Length:456 Species:Arabidopsis thaliana


Alignment Length:382 Identity:85/382 - (22%)
Similarity:132/382 - (34%) Gaps:112/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HIRVPKLDMLMKILLDFE---YDTDLTKWTEAQFLSEYFYNCSKFVLEDPGVQELLRNA------ 131
            ||.:..::....:|...|   |..||..:::.            ...|||...|.|..:      
plant    40 HINLATIESARDLLSTVEKPRYPVDLVFFSDG------------LPKEDPKAPETLLKSLNKVGA 92

  Fly   132 --------SAKYSLII----------LEASHNDALYGFSQHFNAPLLGVAAYG--SSWNIDFLVG 176
                    ..:||.||          :.||||         .:..:|.:.|.|  |.:...::..
plant    93 MNLSKIIEEKRYSCIISSPFTPWVPAVAASHN---------ISCAILWIQACGAYSVYYRYYMKT 148

  Fly   177 NSAPSVYEPMSALGYTSGLNLIEKWHNLIYITEERLVERFIYLPRQIDLYKQHFPGATTSIHDLR 241
            ||.|.:.:    |..|..|..:.       :.|.|.:..|: ||..    ..||........|..
plant   149 NSFPDLED----LNQTVELPALP-------LLEVRDLPSFM-LPSG----GAHFYNLMAEFADCL 197

  Fly   242 RRFSLVLINQHFTMGRVRSNVPNIVEVAGMHLDEKPY----PL-------DAELK----KILD-- 289
            |....||:|..:.:..         |:.....|.||.    ||       |.|.:    |.||  
plant   198 RYVKWVLVNSFYELES---------EIIESMADLKPVIPIGPLVSPFLLGDGEEETLDGKNLDFC 253

  Fly   290 ------------EAEHGVIYFSMG--LQLLDHWLPPGMRASMSDAFAQL-----KQQVIWKTDYP 335
                        :|...|:|.|.|  |:.|::.:....:|..:.....|     |::........
plant   254 KSDDCCMEWLDKQARSSVVYISFGSMLETLENQVETIAKALKNRGLPFLWVIRPKEKAQNVAVLQ 318

  Fly   336 EMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQ 392
            |||.:.:.|... |.||..||:|..:..|:||.|..|.:|:|...||::..|.:.||
plant   319 EMVKEGQGVVLE-WSPQEKILSHEAISCFVTHCGWNSTMETVVAGVPVVAYPSWTDQ 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 85/382 (22%)
UDPGT 39..507 CDD:278624 85/382 (22%)
UGT84B1NP_179907.1 PLN02210 1..456 CDD:215127 85/382 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.