DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT84B2

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_179906.1 Gene:UGT84B2 / 816857 AraportID:AT2G23250 Length:438 Species:Arabidopsis thaliana


Alignment Length:422 Identity:79/422 - (18%)
Similarity:140/422 - (33%) Gaps:151/422 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 FSQHFNAPLLGVAAYGSSWNIDF----------LVGNSAPSVYEPMSALGYTSGL---------- 195
            |..|.| |:|..|.:.:..|:.|          |:.::|...:.|:....::.||          
plant     6 FQGHLN-PMLKFAKHLARTNLHFTLATTEQARDLLSSTADEPHRPVDLAFFSDGLPKDDPRDPDT 69

  Fly   196 --NLIEK--WHNLIYITEERLVERFIYLP------------------------RQIDLYKQHF-- 230
              ..::|  ..||..|.||:..:..|.:|                        ....:|.:::  
plant    70 LAKSLKKDGAKNLSKIIEEKRFDCIISVPFTPWVPAVAAAHNIPCAILWIQACGAFSVYYRYYMK 134

  Fly   231 --------------------------------PGATTSIHDLRRRFS-------LVLINQHFTMG 256
                                            |....:::.|...|:       .||:|..:.:.
plant   135 TNPFPDLEDLNQTVELPALPLLEVRDLPSLMLPSQGANVNTLMAEFADCLKDVKWVLVNSFYELE 199

  Fly   257 ----RVRSNVPNIVEVAGMHLDEKPYPLDAELKKILD--------------EAEHGVIYFSMG-- 301
                ...|::..|:.:..:   ..|:.|..:.:|.||              :|...|:|.|.|  
plant   200 SEIIESMSDLKPIIPIGPL---VSPFLLGNDEEKTLDMWKVDDYCMEWLDKQARSSVVYISFGSI 261

  Fly   302 LQLLDH-----------------WLPPGMRASMSDAFAQLKQQVIWKTDYPEMVNQSRNVFARTW 349
            |:.|::                 |:   :|........|:.|         |||.:.:.|... |
plant   262 LKSLENQVETIATALKNRGVPFLWV---IRPKEKGENVQVLQ---------EMVKEGKGVVTE-W 313

  Fly   350 FPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRMEK---LGVARKLD-- 409
            ..|..||:|..:..||||.|..|.||:|...||::..|.:.||..:.:.:..   :||..|.|  
plant   314 GQQEKILSHMAISCFITHCGWNSTIETVVTGVPVVAYPTWIDQPLDARLLVDVFGIGVRMKNDAI 378

  Fly   410 ---FKNLFRDEIVLAIEDLVYNASYKRNARDL 438
               .|....:..:.|:.:....|..:|.|.:|
plant   379 DGELKVAEVERCIEAVTEGPAAADMRRRATEL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 79/422 (19%)
UDPGT 39..507 CDD:278624 79/422 (19%)
UGT84B2NP_179906.1 PLN02210 1..438 CDD:215127 79/422 (19%)
YjiC 8..420 CDD:224732 78/420 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.