DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT2G23210

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001318272.1 Gene:AT2G23210 / 816853 AraportID:AT2G23210 Length:287 Species:Arabidopsis thaliana


Alignment Length:330 Identity:63/330 - (19%)
Similarity:107/330 - (32%) Gaps:114/330 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LLITPFLRNLVQRGHQLTLISAVTIMPHIEGVHHIRVPKLDMLMKILLDFEYDTDLTKWT-EAQF 106
            ::..||      :||         :.|.::...|:....|..   .|...|...||...| |...
plant    13 MVALPF------QGH---------LNPMLKFAKHLARTNLHF---TLATIESARDLLSSTDEPHS 59

  Fly   107 LSEYFYNCSKFVLEDP----GVQELLRNASA-KYSLII-------------------LEASHN-- 145
            |.:..:.......:||    .:.|.||...| .:|.||                   :.|:||  
plant    60 LVDLVFFSDGLPKDDPRDHEPLTESLRKVGANNFSKIIEGKRFDCIISVPFTPWVPAVAAAHNIP 124

  Fly   146 ------DALYGFSQHFNAPLLGVAAYGSSWNIDFLVGNSAPSVYEPMSALGYTSGLNLIE----- 199
                  :|..|||.::..               ::..||.|.:.:|...: ...||..:|     
plant   125 CAILWIEACAGFSVYYRY---------------YMKTNSFPDLEDPNQKV-ELPGLPFLEVRDLP 173

  Fly   200 ----KWHNLIYITEERLVERFIYLPRQIDLYKQHFPGATTSIHDLRRRFSLVLINQHFTMGRVRS 260
                ..|..|:.|   |:..|:...:.:...      ...|.::|..    |:|...|.:..:..
plant   174 TLMLPSHGAIFNT---LMAEFVECLKDVKWV------LANSFYELES----VIIESMFDLKPIIP 225

  Fly   261 NVPNIVEVAGMHLDEKPYPLDAELKKILDEAEHGVIYFSMGLQLLD----HWLPPGMRAS----M 317
            ..|.:          .|:.|.|:..||||..       |:.:...|    .||...:|:|    :
plant   226 IGPLV----------SPFLLGADEDKILDGK-------SLDMWKADDYCMEWLDKQVRSSVFTYL 273

  Fly   318 SDAFA 322
            |:|::
plant   274 SEAYS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 63/330 (19%)
UDPGT 39..507 CDD:278624 63/330 (19%)
AT2G23210NP_001318272.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.