DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT2G22930

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_179877.1 Gene:AT2G22930 / 816824 AraportID:AT2G22930 Length:442 Species:Arabidopsis thaliana


Alignment Length:436 Identity:81/436 - (18%)
Similarity:148/436 - (33%) Gaps:152/436 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YTFGSSYLLITPFL---RNLVQRGHQLTLI---------------------SAVTIMPHIEGV-- 74
            :.||.    :.|||   ..|.::|||:|.:                     ..:|| ||:.|:  
plant    13 FAFGH----MIPFLHLANKLAEKGHQITFLLPKKAQKQLEHHNLFPDSIVFHPLTI-PHVNGLPA 72

  Fly    75 -----HHIRVPKLDMLMKILLDFEYD----------TDLTKWTEAQFLSEYFYNCSKFVLEDPGV 124
                 ..|.: .:|.|:...||...|          .||..:..|.::.|.            ..
plant    73 GAETTSDISI-SMDNLLSEALDLTRDQVEAAVRALRPDLIFFDFAHWIPEI------------AK 124

  Fly   125 QELLRNASAKYSLIILEASHNDALYGFSQHFNAP--LLGVAAYGSSWNIDFLVGNSAPSVYEPMS 187
            :.::::.|  |.::    |.....|.|     ||  :|||...|..         |:..:|....
plant   125 EHMIKSVS--YMIV----SATTIAYTF-----APGGVLGVPPPGYP---------SSKVLYREND 169

  Fly   188 ALGYTSGLNLIEKWHNLIYITEERLVERFIYLPRQIDLYKQHFPG-------ATTSIHDLRRRFS 245
            |             |.|..::        |:..|   ||.|...|       |..:.:::..:|.
plant   170 A-------------HALATLS--------IFYKR---LYHQITTGFKSCDIIALRTCNEIEGKFC 210

  Fly   246 LVLINQHFTMGRVRSNVPNIVEVAGMHLDEKPYPLDAELKKILDE-AEHGVIYFSMGLQLL---D 306
            ..:.:|:..  :|....|.:.|      .:...||:.:|...|.. ....|::.::|.|::   |
plant   211 DYISSQYHK--KVLLTGPMLPE------QDTSKPLEEQLSHFLSRFPPRSVVFCALGSQIVLEKD 267

  Fly   307 HW------------------LPPGMRASMSDAFAQLKQQVIWKTDYPEMVNQSRNVFARTWFPQR 353
            .:                  .||...:::.:...:..|:.:          :.|.|....|..|.
plant   268 QFQELCLGMELTGLPFLIAVKPPRGSSTVEEGLPEGFQERV----------KGRGVVWGGWVQQP 322

  Fly   354 AILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKRM 399
            .||:||::..|:.|.|..::.|.:.....::.:|...||...|:.|
plant   323 LILDHPSIGCFVNHCGPGTIWECLMTDCQMVLLPFLGDQVLFTRLM 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 81/436 (19%)
UDPGT 39..507 CDD:278624 80/433 (18%)
AT2G22930NP_179877.1 Glycosyltransferase_GTB_type 1..442 CDD:299143 81/436 (19%)
MGT 8..403 CDD:273616 81/436 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.