DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT2G18560

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_179446.2 Gene:AT2G18560 / 816371 AraportID:AT2G18560 Length:380 Species:Arabidopsis thaliana


Alignment Length:247 Identity:64/247 - (25%)
Similarity:106/247 - (42%) Gaps:61/247 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 VRSNVPNIVEVAGMHLDEKPYPLDAELKKILDEAEHGVIY----------------FSMGLQLLD 306
            ||:||          |.|||......|.|   :.|..|:|                .:.||:|..
plant   155 VRTNV----------LIEKPNSTFEWLDK---QEERSVVYVCLGSGGTLSFEQTMELAWGLELSC 206

  Fly   307 H---WL---PPG-MRASMSDAFAQLKQQVIWKTDYPE-MVNQSRNV--FARTWFPQRAILNHPNV 361
            .   |:   ||. :.||..|     ..||  ....|| .::::|.|  ....|.||..||:|.::
plant   207 QSFLWVLRKPPSYLGASSKD-----DDQV--SDGLPEGFLDRTRGVGLVVTQWAPQVEILSHRSI 264

  Fly   362 KLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQN-TKRMEKLGVA---RKLDFKNLF-RDEIVLA 421
            ..|::|.|..|::||:...||::..||:.:|:.| |...|::|:|   .:|..|.:. |:|:...
plant   265 GGFLSHCGWSSVLESLTKGVPIIAWPLYAEQWMNATLLTEEIGMAIRTSELPSKKVISREEVASL 329

  Fly   422 IEDLVYNASYKRNARDLSQRFHDQPMSAMDTAIWWTEYILRHKGADHMRIAE 473
            ::.:|  |...:..|.:..:..:..:|:...   ||     |.|:.|..:.|
plant   330 VKKIV--AEEDKEGRKIKTKAEEVRVSSERA---WT-----HGGSSHSSLFE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 61/237 (26%)
UDPGT 39..507 CDD:278624 64/247 (26%)
AT2G18560NP_179446.2 Glycosyltransferase_GTB_type 1..380 CDD:299143 64/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.