DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and AT2G16890

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_179281.3 Gene:AT2G16890 / 816190 AraportID:AT2G16890 Length:478 Species:Arabidopsis thaliana


Alignment Length:493 Identity:100/493 - (20%)
Similarity:179/493 - (36%) Gaps:152/493 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YLLITPFLRNLVQRGHQLTLISAVTIMPHIEGVHHIRVPKLDMLM-------KILLDFEYDTDLT 99
            ::::.||:    .:||.:.|:....::..    ||.:.|.:.:.:       ..:.||..||...
plant     9 HVVLFPFM----SKGHIIPLLQFGRLLLR----HHRKEPTITVTVFTTPKNQPFISDFLSDTPEI 65

  Fly   100 KWTEAQF------------LSEYFYNCSKFV-------LEDPGVQELLRNASAKYSLIILEASHN 145
            |.....|            .:|...:.|.||       |..|..:|.|:.. .|.|.::.:    
plant    66 KVISLPFPENITGIPPGVENTEKLPSMSLFVPFTRATKLLQPFFEETLKTL-PKVSFMVSD---- 125

  Fly   146 DALYGF-------SQHFNAPLLGVAAYGSSWNIDFLVGNSAPSVYEPMSALGYTSGLNLIEKWHN 203
                ||       :..||.|..  .:||.:                     .|::.:::....|.
plant   126 ----GFLWWTSESAAKFNIPRF--VSYGMN---------------------SYSAAVSISVFKHE 163

  Fly   204 LIYITEERLVERFIYLP--RQIDLYKQHFPGATTSIHDLRRRFSLVLINQHFTMGRVRSN----- 261
            |....|.:.....:.:|  ..|.:.|..|...||...:......|       :|.:::|.     
plant   164 LFTEPESKSDTEPVTVPDFPWIKVKKCDFDHGTTEPEESGAALEL-------SMDQIKSTTTSHG 221

  Fly   262 --VPNIVEVAGMHLD------EKPY------------PLDAELKKI----LDE-AEHG--VIYFS 299
              |.:..|:....:|      :||.            |.....|..    ||: .|.|  |:|.:
plant   222 FLVNSFYELESAFVDYNNNSGDKPKSWCVGPLCLTDPPKQGSAKPAWIHWLDQKREEGRPVLYVA 286

  Fly   300 MGLQLLDHWLPPGMRASMSD------AFA--QLKQQVIWKT--DYPEMVNQSRN-------VFAR 347
            .|.|           |.:|:      ||.  ..|...:|.|  |..|::.:..|       :..|
plant   287 FGTQ-----------AEISNKQLMELAFGLEDSKVNFLWVTRKDVEEIIGEGFNDRIRESGMIVR 340

  Fly   348 TWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPLLCIPLFYDQFQNTKR-MEKLGVARKLDFK 411
            .|..|..||:|.:||.|::|.|..|..||:...||||..|:..:|..|.|. :|::.|..:::.:
plant   341 DWVDQWEILSHESVKGFLSHCGWNSAQESICVGVPLLAWPMMAEQPLNAKMVVEEIKVGVRVETE 405

  Fly   412 N------LFRDEIVLAIEDLVYNASYK---RNARDLSQ 440
            :      :.|:|:...|::|:...:.|   :|.::.|:
plant   406 DGSVKGFVTREELSGKIKELMEGETGKTARKNVKEYSK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 100/493 (20%)
UDPGT 39..507 CDD:278624 100/493 (20%)
AT2G16890NP_179281.3 Glycosyltransferase_GTB_type 9..467 CDD:299143 100/493 (20%)
YjiC 9..440 CDD:224732 99/488 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.