DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT73B5

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001189528.1 Gene:UGT73B5 / 816040 AraportID:AT2G15480 Length:494 Species:Arabidopsis thaliana


Alignment Length:506 Identity:99/506 - (19%)
Similarity:167/506 - (33%) Gaps:169/506 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLLF-----GLLCPKLTNAENILAVFSYTFGSSYLLITPFLRNLVQRGHQLTLISAVTIM-PHIE 72
            :|.|     |.:.|.|..|:    :||.....|.||.||....:.::.     |.|.... |.:|
plant    11 ILFFPFMAQGHMIPILDMAK----LFSRRGAKSTLLTTPINAKIFEKP-----IEAFKNQNPDLE 66

  Fly    73 -GVHHIRVPKL-----------------------DMLMKILLDFEY-DTDLTKWTE----AQFLS 108
             |:.....|.:                       |:.:|.|...:| ...|..:.|    :..::
plant    67 IGIKIFNFPCVELGLPEGCENADFINSYQKSDSGDLFLKFLFSTKYMKQQLESFIETTKPSALVA 131

  Fly   109 EYFYNCSKFVLEDPGVQELLRNASAKYSLIILEASHNDALYGFSQHFNAPLLGVAAYGSSWNIDF 173
            :.|:..:....|..||..|:.:.::.:||..          .::...:.|...||.         
plant   132 DMFFPWATESAEKLGVPRLVFHGTSFFSLCC----------SYNMRIHKPHKKVAT--------- 177

  Fly   174 LVGNSAPSVYEPMSALGYTSGLNLIEKWHNLIYITEERLVERFIYLPRQIDLYKQHFPGATTSIH 238
               :|.|.|..     |....:.:.|...|:  ..||..:.:|:...|:.:  ...|.....|.:
plant   178 ---SSTPFVIP-----GLPGDIVITEDQANV--AKEETPMGKFMKEVRESE--TNSFGVLVNSFY 230

  Fly   239 DLRRRFS----------------LVLINQHFTMGRVRSNVPNIVEVAGMHLDEKPYPLDAELKKI 287
            :|...::                |.|.|:.......|....||        ||:      |..|.
plant   231 ELESAYADFYRSFVAKRAWHIGPLSLSNRELGEKARRGKKANI--------DEQ------ECLKW 281

  Fly   288 LDEAEHG-VIYFSMGL-------QLL--------------------------DHWLPPGMRASMS 318
            ||....| |:|.|.|.       |||                          :.|||.|.:...:
plant   282 LDSKTPGSVVYLSFGSGTNFTNDQLLEIAFGLEGSGQSFIWVVRKNENQGDNEEWLPEGFKERTT 346

  Fly   319 DAFAQLKQQVIWKTDYPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESVHYAVPL 383
                                  .:.:....|.||..||:|..:..|:||.|..|.||.:...:|:
plant   347 ----------------------GKGLIIPGWAPQVLILDHKAIGGFVTHCGWNSAIEGIAAGLPM 389

  Fly   384 LCIPLFYDQFQNTKRMEK---LGV---ARKLDFKN--LFRDEIVLAIEDLV 426
            :..|:..:||.|.|.:.|   :||   |.:|..|.  :.|.::..|:.:::
plant   390 VTWPMGAEQFYNEKLLTKVLRIGVNVGATELVKKGKLISRAQVEKAVREVI 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 94/489 (19%)
UDPGT 39..507 CDD:278624 91/476 (19%)
UGT73B5NP_001189528.1 PLN03007 4..494 CDD:178584 99/506 (20%)
MGT 14..456 CDD:273616 98/503 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.