DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and UGT2B17

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001068.1 Gene:UGT2B17 / 7367 HGNCID:12547 Length:530 Species:Homo sapiens


Alignment Length:529 Identity:139/529 - (26%)
Similarity:246/529 - (46%) Gaps:94/529 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSYLLITPFLRNLVQRGHQ-LTLISAVTIMPHIEGVHHIRVPKLDMLMKILLDFEYDTDLTK--- 100
            |.::.:...|..||||||: :.|.|:.:|:.:......|   ||::         |.|.|||   
Human    34 SHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAI---KLEV---------YPTSLTKNDL 86

  Fly   101 ----------WT----EAQFLSEYF------------YN---CSKFVLEDPGVQELLRN-ASAKY 135
                      ||    :..|.| ||            ||   |...||.    ::|:|. ..:|:
Human    87 EDFFMKMFDRWTYSISKNTFWS-YFSQLQELCWEYSDYNIKLCEDAVLN----KKLMRKLQESKF 146

  Fly   136 SLIILEASHNDALYGFSQHFNAPLLGVAAYGSSWNIDFLV-----GNSAPSVYEPMSALGYTSGL 195
            .:::.:|. |......::..|.|.|    |...:::.:.|     |...|..|.|:.....:..:
Human   147 DVLLADAV-NPCGELLAELLNIPFL----YSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQM 206

  Fly   196 NLIEKWHNLIYITEERLVERFIYLPRQIDLYKQHFP---GATTSIHDLRRRFSLVLINQHFTMGR 257
            ..:|:..|:||:    |...|.:....:..:.|.:.   |..|::.:...:..:.||..::....
Human   207 IFMERIKNMIYM----LYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEF 267

  Fly   258 VRSNVPNIVEVAGMHLDEKP-YPLDAELKKILDEA-EHGVIYFSMGLQLLDHWLPPGMRASMSD- 319
            .|..:||:..|.|:|.  || .||..|:::.:..: |:|::.||:|          .|.::||: 
Human   268 PRPFLPNVDFVGGLHC--KPAKPLPKEMEEFVQSSGENGIVVFSLG----------SMISNMSEE 320

  Fly   320 -------AFAQLKQQVIWKTDYPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLSLIESV 377
                   |.||:.|:|:|:.|..:......|.....|.||..:|.||..|.||||.|...:.|::
Human   321 SANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAI 385

  Fly   378 HYAVPLLCIPLFYDQFQNTKRMEKLGVARKLDFKNLFRDEIVLAIEDLVYNASYKRNARDLSQRF 442
            ::.:|::.||||.||..|...|:..|.|..:|.:.:...:::.|::.::.:..||.|...||:..
Human   386 YHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIH 450

  Fly   443 HDQPMSAMDTAIWWTEYILRHKGADHMRIAEQEMSLMQYYNVDVVSVLFGRIGLSAIIVIFLGWK 507
            ||||:..:|.|::|.|:::|||||.|:|:|...::.:||:::||::.|...:.    .:||:..|
Human   451 HDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVA----TMIFMITK 511

  Fly   508 LVSLATRHL 516
            ......|.|
Human   512 CCLFCFRKL 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 123/476 (26%)
UDPGT 39..507 CDD:278624 136/518 (26%)
UGT2B17NP_001068.1 UDPGT 24..518 CDD:278624 137/525 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150261
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.