DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and Ugt2a2

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001019319.1 Gene:Ugt2a2 / 552899 MGIID:3576095 Length:528 Species:Mus musculus


Alignment Length:520 Identity:136/520 - (26%)
Similarity:259/520 - (49%) Gaps:45/520 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLTVLLFGLLCPKLTNAENILAVFSYTFGSSYLLITPFLRNLVQRGHQLTLIS---AVTIMPHIE 72
            :|.:|:|.|...::..:.|:  |...|.||.:|.|...|..||||.|.:|:::   .:.|...::
Mouse     5 VLQLLIFHLTLAEIVLSGNV--VVWPTDGSHWLNIKILLEELVQRNHSVTVLAPSETLFINSRLD 67

  Fly    73 G-VHHIRVP------KLDMLMKILLDFEYD---TDLTKWT---EAQFLSEYFYNCSK----FVLE 120
            . ::...:|      |:|.:::.::....|   |.||.||   |...|...||..:|    .||.
Mouse    68 AFINFEEIPVSYTKSKIDEIIEHMIALWLDHRPTPLTMWTFYKELGNLLATFYTTNKQMCDGVLN 132

  Fly   121 DPGVQELLRNASAKYSLIILEASHNDALYG--FSQHFNAPLLGVAAYGSSWNIDFLVGN-SAPSV 182
            :|.|.|.|:...  :.:::.:..   .:.|  .:.....|.:....:..::.::...|. .||..
Mouse   133 NPTVMERLQKGG--FDVLLADPV---TMCGELVALKLGIPFVYTLRFSPAFTVERHCGKIPAPIS 192

  Fly   183 YEPMSALGYTSGLNLIEKWHNLI-YITEERLVERFIYLPRQIDLYKQHFPGATTSIHDLRRRFSL 246
            |.|.:....|..::..|:..|:| |..::.:.:.:.   .:.:.|.....|..|::.:...:..:
Mouse   193 YVPAALSELTDQMSFGERVKNIISYSLQDYIFKTYW---GEWNSYYSKVLGRPTTLCETMGKAEI 254

  Fly   247 VLINQHFTMGRVRSNVPNIVEVAGMHLDEKP-YPLDAELKKILD-EAEHGVIYFSMGLQLLDHWL 309
            .|:..::.....|..:||...|.|:|.  || .||..|:::.:. ..|||::.||:|..:.:  |
Mouse   255 WLMRTYWDFEFPRPYLPNFEFVGGLHC--KPAKPLPKEMEEFVQTSGEHGIVVFSLGSMVKN--L 315

  Fly   310 PPGMRASMSDAFAQLKQQVIW--KTDYPEMVNQSRNVFARTWFPQRAILNHPNVKLFITHAGLLS 372
            .......::.|.||:.|:|:|  |...|:.:..:..:|  .|.||..:|.||..:.||||.|...
Mouse   316 TDEKANLIASALAQIPQKVLWRYKGKIPDTLGSNTRLF--DWIPQNDLLGHPKTRAFITHGGTNG 378

  Fly   373 LIESVHYAVPLLCIPLFYDQFQNTKRMEKLGVARKLDFKNLFRDEIVLAIEDLVYNASYKRNARD 437
            :.|::::.:|::.:|:|.||..|...|:..|.|.:::...:...:::.|:..::...|||.||..
Mouse   379 IYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMTSSDLLNALRTVINEPSYKENAMR 443

  Fly   438 LSQRFHDQPMSAMDTAIWWTEYILRHKGADHMRIAEQEMSLMQYYNVDVVSVLFGRIGLSAIIVI 502
            ||:..||||:..:|.|::|.|:::|||||.|:|:|..::|..||:::||:..|...:. |||:::
Mouse   444 LSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWFQYHSLDVIGFLLACVA-SAILLV 507

  Fly   503  502
            Mouse   508  507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 117/466 (25%)
UDPGT 39..507 CDD:278624 129/492 (26%)
Ugt2a2NP_001019319.1 UDPGT 22..516 CDD:278624 132/503 (26%)
egt <267..487 CDD:223071 73/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 272 1.000 Inparanoid score I2975
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - otm42461
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.